DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3631 and fam20a.2

DIOPT Version :9

Sequence 1:NP_650398.3 Gene:CG3631 / 41797 FlyBaseID:FBgn0038268 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_031750224.1 Gene:fam20a.2 / 101733011 XenbaseID:XB-GENE-22063721 Length:413 Species:Xenopus tropicalis


Alignment Length:409 Identity:129/409 - (31%)
Similarity:199/409 - (48%) Gaps:77/409 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 FFMFRNKLLKNYKAAPYENASVLWDIAN----WWPHENEV-----YPLYDSSMGQLLETLRREPI 120
            |...||:....:.||...:|.|.....|    |.....|:     ||....::.||:|.:....|
 Frog     2 FVCCRNQEHLTHHAAWNSSAHVTEAALNVSAPWMQFHLEISRDALYPRASRNVEQLIEWMGNINI 66

  Fly   121 TR------VSNLGR-----------GTQLKLLVRLSHQQKVIFKPQWYPREEVIDGMIYSGKD-- 166
            .|      ...|..           ||.|||:|:.....:.:|||....|:|.....::...|  
 Frog    67 IRADLPFDTKKLNEECDCDQIVKPSGTHLKLVVQFQDLGRAMFKPMRQSRDEETSEDVFYFVDFQ 131

  Fly   167 RHTAEVYAFYLGAVLDFRWTPIVVGRVVNLKKEIYAKGDPELQQTINIETDEDGREKY------- 224
            ||.||:.||:|..:||||..|.|.||:||:.||:           :.:.:||:.::.:       
 Frog   132 RHNAEIAAFHLDRILDFRRVPPVAGRLVNMTKEL-----------LEMASDENLQDVFFLSPANN 185

  Fly   225 -CLFGKCHY-CNEEETVCGDERHNIEGVLIYIVPG-TLAKR---RSPWQRTYKDDKRAPWEDDMT 283
             |||.:|.| |..|..|||:. |.:||.|...:|. :.|.|   ::||:|:|....:..||.:.:
 Frog   186 VCLFARCPYTCKTEYAVCGNP-HMLEGSLSAFLPSHSQAFRYSVQNPWKRSYTFTGKEDWEVNPS 249

  Fly   284 YCKSLK------NKMETIRLLDLIDASIFDYLIQNGDRHHYET----REERVVL-IDNGKAFGNP 337
            ||..:|      |:.   |||:::|.:|||:||.|.|||||:.    .::..:| :||.:.||..
 Frog   250 YCDQVKQTEPYTNRK---RLLNMMDLAIFDFLIGNMDRHHYDVFSKFGDDGFMLHMDNARGFGRH 311

  Fly   338 NKDHLDILAPLYQCCLLRKSTWDRLQVFS------GGVLTEIIDRLSKQDALYPLITDKHKKGVE 396
            :.|.:.||||:|||||:::.||.||::.|      ..|:.|.:.|    |.|..::|:.|...::
 Frog   312 SLDEITILAPVYQCCLVKEDTWLRLRLLSRPEYRLSDVMRESLSR----DLLETVLTEPHLLALD 372

  Fly   397 RRLLVVYAVVEHCMDIEGD 415
            |||..|..|||.|:...|:
 Frog   373 RRLQKVLQVVEECVQKHGE 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3631NP_650398.3 FAM20_C_like 224..414 CDD:297333 77/219 (35%)
fam20a.2XP_031750224.1 Fam20C 178..395 CDD:399590 78/222 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D227822at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.