DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3631 and LOC100536075

DIOPT Version :9

Sequence 1:NP_650398.3 Gene:CG3631 / 41797 FlyBaseID:FBgn0038268 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_003201806.4 Gene:LOC100536075 / 100536075 -ID:- Length:143 Species:Danio rerio


Alignment Length:123 Identity:48/123 - (39%)
Similarity:80/123 - (65%) Gaps:7/123 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 LIDASIFDYLIQNGDRHHYE--TR--EERVVL-IDNGKAFGNPNKDHLDILAPLYQCCLLRKSTW 359
            :||.::||:|..|.||||||  |:  :|..:| :||.:.||..:.|.|.|||||.|||::::||.
Zfish     1 MIDMAVFDFLTGNMDRHHYEIFTKFGDEGFLLHLDNARGFGRHSHDELSILAPLTQCCMIKRSTL 65

  Fly   360 DRLQVFSGG--VLTEIIDRLSKQDALYPLITDKHKKGVERRLLVVYAVVEHCMDIEGD 415
            .||::.|..  :|::::.....:|||.|::|::|.:.::|||......|:.|:|..|:
Zfish    66 FRLKLLSSSEYLLSDVMRESLSRDALSPVLTEEHLQALDRRLKHTLLAVDTCVDKHGE 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3631NP_650398.3 FAM20_C_like 224..414 CDD:297333 47/120 (39%)
LOC100536075XP_003201806.4 FAM20_C_like <1..127 CDD:323276 48/123 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D227822at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.