DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3631 and cabp7

DIOPT Version :10

Sequence 1:NP_650398.3 Gene:CG3631 / 41797 FlyBaseID:FBgn0038268 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_002934336.2 Gene:cabp7 / 100497989 XenbaseID:XB-GENE-951867 Length:215 Species:Xenopus tropicalis


Alignment Length:43 Identity:14/43 - (32%)
Similarity:21/43 - (48%) Gaps:17/43 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GANFYFMYY------LSAEE----------GHLASVRALENMI 47
            ||:|..:::      ||.||          .|| |:|.:||:|
 Frog   113 GADFDTVFWKCDMQSLSVEELKRLLYDTFCEHL-SMRDIENII 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3631NP_650398.3 FAM20_C_like 224..414 CDD:471362
cabp7XP_002934336.2 PTZ00184 26..154 CDD:185504 13/41 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.