DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14857 and OCT1

DIOPT Version :9

Sequence 1:NP_650392.1 Gene:CG14857 / 41791 FlyBaseID:FBgn0038262 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_565059.2 Gene:OCT1 / 843656 AraportID:AT1G73220 Length:539 Species:Arabidopsis thaliana


Alignment Length:435 Identity:105/435 - (24%)
Similarity:183/435 - (42%) Gaps:48/435 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 AELNWVCNDAYKARIGQSLFFLGSLMGTFTFGVLGDR-IGRVRAVILANQCGFVGDFLTTYASNL 172
            :|.|.:|...:...:..:|||:|||.|:..:|.|.|. .||.:.::|:....||..|..:::.|:
plant   124 SEWNLICQHKFLVAVPSTLFFIGSLFGSGVYGYLADSWFGRKKTLLLSCVLTFVTAFAISFSPNV 188

  Fly   173 VQFAIFRCISGLAATANYYLMFILVLEYLAPKLRNMAISGTLG-ICFCLGALVAPWLSVL-AGNW 235
            ..:|..|..:|...:.......:|..|.:..|.|...  |..| ..|.||.|..|.::.| ..:|
plant   189 WVYAFLRFANGFFRSGIGSCCIVLATEIVGKKWRGQV--GQYGFFFFTLGFLSLPLMAYLERKSW 251

  Fly   236 R-IYLTCSAL-LQLVVALFYFVVQESAQWLITRTNVEGAIARLKHIAHFNGMEVKAADFEAFRRN 298
            | :|...|.| |...|.|..| ..||.:||:.:...:.|:..||.:|..||.::.|        :
plant   252 RNLYRIISFLPLGYAVCLLPF-AYESPRWLLVKGRNKEAMVVLKKLARLNGKQLPA--------D 307

  Fly   299 CIVKRKLSNQPEQTAGIFDLLRTPNLRKVSLLVVFTFMLTSLSFNTISRNVEGMGLSPFVVFSLF 363
            ..:...:..:.:||:......:|....|..::|:.....:...:..|..|.|.:..:.::..::.
plant   308 LSLVDPIPERDDQTSSSEKFWKTKWAVKRIIMVMMAGFGSGFVYYGIQLNAENLNFNLYLTVAVN 372

  Fly   364 AVVVPPSGFIQGLLQSRVGRK--------ATAFLAMLCTGL--------LSCALGVALSTEGAQK 412
            |::..|:.||...|...:.|:        ...|..:||..|        :|.|..:.|:.|.   
plant   373 ALMEFPAVFIGSFLLGVMNRRPLFSNSSYLAGFACLLCAVLSIHRVIRAISVAKWLQLAVEA--- 434

  Fly   413 NVTLLLAFALPMRLGISMCYTVTSQFASELLPTCVRSRGIAAVHLAAAGASFVSPYLIHLGTKLA 477
                 :.|     :..|..|.|...:..||.||.||:..::.:..|....:..:|.|:.||.:.|
plant   435 -----VGF-----MASSTAYDVLYVYCVELFPTNVRNTAVSLLRQAFMLGASAAPLLVALGRESA 489

  Fly   478 AAPSLILALLLLTASGCTLMLPETNNRQLPITLADGEAFGKGESM 522
            ....::..:..:.:...:|.|.||.|..|..|||..   ||.|.:
plant   490 MMSFIVFGVASVLSGIVSLWLRETRNAPLYETLAQQ---GKAEEI 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14857NP_650392.1 2A0119 11..509 CDD:273328 99/420 (24%)
MFS 126..470 CDD:119392 86/364 (24%)
OCT1NP_565059.2 MFS_OCT_plant 102..511 CDD:340936 94/410 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X24
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.