DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14856 and SLC22A6

DIOPT Version :9

Sequence 1:NP_650391.1 Gene:CG14856 / 41790 FlyBaseID:FBgn0038261 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_004781.2 Gene:SLC22A6 / 9356 HGNCID:10970 Length:563 Species:Homo sapiens


Alignment Length:542 Identity:121/542 - (22%)
Similarity:234/542 - (43%) Gaps:47/542 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MDFDEILVKCGDSHRYQYMLLALYGLLMFIVSRHYFAQNVIGFVPDHWCYHEQLENRSYAEIAAI 67
            |.|:::|.:.|...|:|.:.:.|..|.:.:::.|...||....:|.|.|......|.|......:
Human     1 MAFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHCRPPADANLSKNGGLEV 65

  Fly    68 YAPFKR----PSCTRLAS-------INMDGSNATASSEPC-NRWIYHYDHGFISMNADLNW--VC 118
            :.|..|    .||.|..|       :|...:|.|.::||| :.||  ||:..........|  ||
Human    66 WLPRDRQGQPESCLRFTSPQWGLPFLNGTEANGTGATEPCTDGWI--YDNSTFPSTIVTEWDLVC 128

  Fly   119 DDAYKARVGQSLFFVGSMCGTLLFGLLGDRIGRIKAVVLANCCGFLGDSATIFAETLLTFSASRF 183
            ......::.|||:.||.:.|.::||.|.||:||.|.::|......:..:...||.....:.|.|.
Human   129 SHRALRQLAQSLYMVGVLLGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAFAPNFPIYCAFRL 193

  Fly   184 VSGLAAEANSYLMFILVLEYVSPTMRSVGLNLTMCV------FYGLGMICASWQGVWLGSWRSFM 242
            :||:|....|.....|.:|::.       ::...||      .|.||....:.....:..||...
Human   194 LSGMALAGISLNCMTLNVEWMP-------IHTRACVGTLIGYVYSLGQFLLAGVAYAVPHWRHLQ 251

  Fly   243 VWTALP--QLLVTGFYFLIQESAQWLVTRQDFDGAELRLRRVAKFN--RRDVSEADYELFRQHCK 303
            :..:.|  ...:..::|:  |||:|..:....|.....|:|||:.|  |.:.::...|:.|    
Human   252 LLVSAPFFAFFIYSWFFI--ESARWHSSSGRLDLTLRALQRVARINGKREEGAKLSMEVLR---- 310

  Fly   304 TKESEARSQMSMQK-QARLIDSFKLPRLRLRLIYVTVVFSIVTLCYNTMSRNVEGLSISPFVMFS 367
               :..:.:::|.| ||..::..:.|.||...:.:::::...:..|..:..:::|..:|.:::..
Human   311 ---ASLQKELTMGKGQASAMELLRCPTLRHLFLCLSMLWFATSFAYYGLVMDLQGFGVSIYLIQV 372

  Fly   368 LFALTLPPSGIFQTQVQKHFGRKFTSVVSMTATGLMTATTGILLAFWTQHSATVMVCLLLMCRFG 432
            :|.....|:.:....|....||:...:.::...|:.....|::    .|..:.|...|.::.:..
Human   373 IFGAVDLPAKLVGFLVINSLGRRPAQMAALLLAGICILLNGVI----PQDQSIVRTSLAVLGKGC 433

  Fly   433 ISVTTGSTMQISTELMPTCVRSSGLAVIHVTAAALSFISPFILHLDTYFRAASSIITCILLLVSA 497
            ::.:.......:.||.||.:|.:|:.:....|...|.:||.:......:.:....|...:.:.::
Human   434 LAASFNCIFLYTGELYPTMIRQTGMGMGSTMARVGSIVSPLVSMTAELYPSMPLFIYGAVPVAAS 498

  Fly   498 WICLLLSETRNKKLPLTLAEGE 519
            .:.:||.||..:.||.|:.:.|
Human   499 AVTVLLPETLGQPLPDTVQDLE 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14856NP_650391.1 2A0119 13..514 CDD:273328 116/525 (22%)
MFS 129..503 CDD:119392 77/384 (20%)
SLC22A6NP_004781.2 2A0119 11..515 CDD:273328 116/525 (22%)
MFS 135..505 CDD:119392 79/389 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 525..563
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153816
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57756
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X24
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.