DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14856 and SLC22A16

DIOPT Version :9

Sequence 1:NP_650391.1 Gene:CG14856 / 41790 FlyBaseID:FBgn0038261 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens


Alignment Length:570 Identity:128/570 - (22%)
Similarity:222/570 - (38%) Gaps:94/570 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDEILVKCGDSHRYQYMLLALYGLLMFIVSRHYFAQNVIGFVPDHWC----------YHE----- 54
            |:.|....|...|:|.:|..:..........||.|...:|..|.|.|          :|.     
Human     6 FEGIYDHVGHFGRFQRVLYFICAFQNISCGIHYLASVFMGVTPHHVCRPPGNVSQVVFHNHSNWS 70

  Fly    55 ------------------QLENRSYAEIAAIYAPFKRPSCTRLASINMD--GSNATASSE--PCN 97
                              ||:|....|::         .|:|....|..  |...|.|.:  ||.
Human    71 LEDTGALLSSGQKDYVTVQLQNGEIWELS---------RCSRNKRENTSSLGYEYTGSKKEFPCV 126

  Fly    98 RWIYHYDHGFISMNADLNW--VCDDAYKARVGQSLFFVGSMCGTLLFGLLGDRIGRIKAVVLANC 160
            .. |.||.......|...|  |||..:.|.:.|.||..|.:.|::.||...||:||...:...:.
Human   127 DG-YIYDQNTWKSTAVTQWNLVCDRKWLAMLIQPLFMFGVLLGSVTFGYFSDRLGRRVVLWATSS 190

  Fly   161 CGFLGDSATIFAETLLTFSASRFVSGLAAEANSYLM--FILVLEYV---SPTMRSVGLNLTMCVF 220
            ..||...|..||....||.|:||.  ||..|:.||:  |:.|:|::   |.|..||.|:    .|
Human   191 SMFLFGIAAAFAVDYYTFMAARFF--LAMVASGYLVVGFVYVMEFIGMKSRTWASVHLH----SF 249

  Fly   221 YGLGMICASWQGVWLGSW---RSFMVWTALPQLLVTGFYFLIQESAQWLVTRQDFDGAELRLRRV 282
            :.:|.:..:..|..:.:|   :..:....:|.:|..   :::.|:..||::...::.|:..:..:
Human   250 FAVGTLLVALTGYLVRTWWLYQMILSTVTVPFILCC---WVLPETPFWLLSEGRYEEAQKIVDIM 311

  Fly   283 AKFNRRDVSEADYELFRQHCKTKE----------SEARSQMSMQKQARLIDSFKLPRLRLRLIYV 337
            ||:||           ...||..|          |.:.:::.....:.|..::.:.:   |.:.|
Human   312 AKWNR-----------ASSCKLSELLSLDLQGPVSNSPTEVQKHNLSYLFYNWSITK---RTLTV 362

  Fly   338 TVVFSIVTLCYNTMSRNVEGLSISPFVMFSLFALTLPPSGIFQTQVQKHFGRKFTSVVSMTATGL 402
            .:::...:|.:.:.|.|...|..:.::...|..:...|:..|........||:.....|:..:.|
Human   363 WLIWFTGSLGFYSFSLNSVNLGGNEYLNLFLLGVVEIPAYTFVCIAMDKVGRRTVLAYSLFCSAL 427

  Fly   403 MTATTGILLAFWTQHSATVMVCLLLMCRFGISVTTGSTMQISTELMPTCVRSSGLAVIHVTAAAL 467
               ..|:::....:| ..:.|...::.:|.|....|.....:.||.||.|||..:....:.....
Human   428 ---ACGVVMVIPQKH-YILGVVTAMVGKFAIGAAFGLIYLYTAELYPTIVRSLAVGSGSMVCRLA 488

  Fly   468 SFISPFILHLDTYFRAASSIITCILLLVSAWICLLLSETRNKKLPLTLAE 517
            |.::||.:.|.:.:.....:....:.|:|..:.|.|.||..|:|..|..|
Human   489 SILAPFSVDLSSIWIFIPQLFVGTMALLSGVLTLKLPETLGKRLATTWEE 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14856NP_650391.1 2A0119 13..514 CDD:273328 124/557 (22%)
MFS 129..503 CDD:119392 85/391 (22%)
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 124/557 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..577
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153542
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57756
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X24
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.