DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14856 and oct2

DIOPT Version :9

Sequence 1:NP_650391.1 Gene:CG14856 / 41790 FlyBaseID:FBgn0038261 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_001107932.1 Gene:oct2 / 797890 ZFINID:ZDB-GENE-080204-92 Length:554 Species:Danio rerio


Alignment Length:575 Identity:130/575 - (22%)
Similarity:253/575 - (44%) Gaps:81/575 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DFDEILVKCGDSHRYQYMLLALYGLLMFIVSRHYFAQNVIGFVPDHWCYHEQLENR---SYAEIA 65
            :|||:|...||...||..:..|..|.:.:::........:|:.|||||....|:.:   |..::.
Zfish     3 NFDELLQHAGDFGFYQKRISVLGSLPILLLAFVLIGVVFLGYTPDHWCKTASLQEKCGFSEEQVR 67

  Fly    66 AIYAP-------FKRPSCTRLASINMDGS---------NATASSEPCNR-WIYHYDHGFISMNAD 113
            .:..|       |.:  |.:......:||         |.:.....||. |.::.:.  .::..:
Zfish    68 DLTVPRTGARGAFSK--CVKFDDALRNGSALSCNISIFNNSTHLSACNEGWTFNENR--TTIVTE 128

  Fly   114 LNWVCDDAYKARVGQSLFFVGSMCGTLLFGLLGDRIGRIKAVVLANCCGFLGDSAT--IFAE--T 174
            .:.||:|::.|.:.|.....|...|.|:.|.|.||.|| |:..:|:..| ||.|.|  ||:.  .
Zfish   129 FSLVCEDSWLADLNQVSLAGGFFIGALVTGYLADRFGR-KSCFIASIFG-LGVSGTCIIFSPYYP 191

  Fly   175 LLTFSASRFVSGLAAEANSYLMFILVLEYVSPTMRSVGLNLTMCVFYGLGMICASWQGVWLGSWR 239
            ||.|  .|.:.|..|:......::|::|:.....|.. :::....||.||::.......::.|||
Zfish   192 LLLF--FRCLQGFFAKGAWTATYVLIIEFFGSNNRKF-VSVMSRTFYSLGLVLLPALAYYIPSWR 253

  Fly   240 SFMVWTALPQLLVTGFYFLIQESAQWLVTRQDFDGAELRLRRVAKFNRRDVSEADYELFRQHCKT 304
            :..:...||..:...::::|.||.:||::::....|...::.:||.|:|.:.|..:|:       
Zfish   254 NLQLAMTLPTFIFLIYHWVIPESPRWLLSQRKTKEALSIVKSIAKCNKRSLPEDFHEM------- 311

  Fly   305 KESEARSQMSMQKQARLI-----DSFKLPRLRLR---LIYV----TVVFSIVTLCYNTMSRNVEG 357
                   .:.::||..::     |.||.|::|..   |||.    .|||..:.|.......||  
Zfish   312 -------DLLIEKQEEIMRPSYKDLFKTPKMRKHTFILIYAWFTGAVVFQGLVLRLGITGDNV-- 367

  Fly   358 LSISPFVMFSLFALTLPPSGIFQTQVQKHFGRKFTSVVSMTATGLMTATTGILLAFWTQHSATVM 422
                 |:.|.:.|:...|:|:....:....||:    ..|.....:.....:.:.|.:.:.:.:.
Zfish   368 -----FLDFLISAVVELPTGLIFYFLVDRIGRR----PLMATVNFIGGAACLAVPFISPNISWLR 423

  Fly   423 VCLLLMCRFGISVTTGSTMQISTELMPTCVRSSGLAVIHVTAAALSFISPFILH-LDTYFRAASS 486
            ..:.::.|..:::...:....:|||.||.:|:.|::|....:...:.::||||: |.:.::....
Zfish   424 RTIAIVGRLAVAIGNETVNFANTELYPTPLRNLGVSVCSSASDIGAVVAPFILYRLASIWQELPL 488

  Fly   487 IITCILLLVSAWICLLLSETRNKKLPLTLAEGEEFGKGERMFDFMRSFKKADQHD 541
            ::..::.::.:.:.:||.|.:...||.|:.:.|.          :||..|..:.|
Zfish   489 LVYGVMSVLYSGLVMLLPEMKGVDLPETVDDVEN----------LRSRHKRKEKD 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14856NP_650391.1 2A0119 13..514 CDD:273328 120/537 (22%)
MFS 129..503 CDD:119392 87/390 (22%)
oct2NP_001107932.1 2A0119 12..516 CDD:273328 120/537 (22%)
MFS 123..506 CDD:119392 93/412 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588932
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57756
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X24
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.