DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14856 and SLC22A2

DIOPT Version :9

Sequence 1:NP_650391.1 Gene:CG14856 / 41790 FlyBaseID:FBgn0038261 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_003049.2 Gene:SLC22A2 / 6582 HGNCID:10966 Length:555 Species:Homo sapiens


Alignment Length:572 Identity:133/572 - (23%)
Similarity:231/572 - (40%) Gaps:95/572 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAMDFDEILVKCGDSHRYQYMLLALYGLLMFIVSRHYFAQNVIGFVPDHWCYH---EQLENR--- 59
            |....|::|...|:.|.:|..:..|..||....:..|.....:||.|||.|..   .:|..|   
Human     1 MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHRCRSPGVAELSLRCGW 65

  Fly    60 SYAEIAAIYAPFKRPS-------CTR---------------LASINMDGSNATASSEPC-NRWIY 101
            |.||......|...|:       |.|               |||::.:.|.....  || :.|:|
Human    66 SPAEELNYTVPGPGPAGEASPRQCRRYEVDWNQSTFDCVDPLASLDTNRSRLPLG--PCRDGWVY 128

  Fly   102 HYDHGFISMNADLNWVCDDAYKARVGQSLFFVGSMCGTLLFGLLGDRIGR---IKAVVLANCCGF 163
            .....  |:..:.|.||.:::...:.||...||...|::..|.:.||.||   :...||.|..  
Human   129 ETPGS--SIVTEFNLVCANSWMLDLFQSSVNVGFFIGSMSIGYIADRFGRKLCLLTTVLINAA-- 189

  Fly   164 LGDSATIFAETLLTFSAS-------RFVSGLAAEANSYLMFILVLEYVSPT-MRSVGLNLTMCVF 220
                    |..|:..|.:       |.:.||.::|...:.:||:.|:|... .|:||:...  |.
Human   190 --------AGVLMAISPTYTWMLIFRLIQGLVSKAGWLIGYILITEFVGRRYRRTVGIFYQ--VA 244

  Fly   221 YGLGMICASWQGVWLGSWRSFMVWTALPQLLVTGFYFLIQESAQWLVTRQDFDGAELRLRRVAKF 285
            |.:|::..:.....|..||......:||......:|:.|.||.:||:::.....|...::.:||.
Human   245 YTVGLLVLAGVAYALPHWRWLQFTVSLPNFFFLLYYWCIPESPRWLISQNKNAEAMRIIKHIAKK 309

  Fly   286 NRRDVSEADYELFRQHCKTKESEARSQMSMQKQARLIDSFKLPRLRLRLIYVTVVFSIVTLCYNT 350
            |.:.:..:     .|..:.:|...:     :.....:|..:.|::|..    |::     |.||.
Human   310 NGKSLPAS-----LQRLRLEEETGK-----KLNPSFLDLVRTPQIRKH----TMI-----LMYNW 355

  Fly   351 MSRNV--EGLSI-------SPFVMFSLFALTLPPSGIFQTQVQKHFGRKFTSVVSMTATGLMTAT 406
            .:.:|  :||.:       :.::.|...||...|:...........||::....|....| ....
Human   356 FTSSVLYQGLIMHMGLAGDNIYLDFFYSALVEFPAAFMIILTIDRIGRRYPWAASNMVAG-AACL 419

  Fly   407 TGILLAFWTQHSATVMVCLLLMCRFGISVTTGSTMQISTELMPTCVRSSGLAVIHVTAAAL---S 468
            ..:.:....|....::.||   .|.||::.......::.||.||.:|:.|   :|:.::..   .
Human   420 ASVFIPGDLQWLKIIISCL---GRMGITMAYEIVCLVNAELYPTFIRNLG---VHICSSMCDIGG 478

  Fly   469 FISPFILH-LDTYFRAASSIITCILLLVSAWICLLLSETRNKKLPLTLAEGE 519
            .|:||::: |...:.....::..:|.||:..:.|||.||:.|.||.|:.|.|
Human   479 IITPFLVYRLTNIWLELPLMVFGVLGLVAGGLVLLLPETKGKALPETIEEAE 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14856NP_650391.1 2A0119 13..514 CDD:273328 127/553 (23%)
MFS 129..503 CDD:119392 85/397 (21%)
SLC22A2NP_003049.2 2A0119 13..525 CDD:273328 127/553 (23%)
MFS 124..492 CDD:119392 88/407 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153649
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57756
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X24
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.