DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14856 and CG14691

DIOPT Version :9

Sequence 1:NP_650391.1 Gene:CG14856 / 41790 FlyBaseID:FBgn0038261 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_650012.2 Gene:CG14691 / 41287 FlyBaseID:FBgn0037829 Length:522 Species:Drosophila melanogaster


Alignment Length:474 Identity:93/474 - (19%)
Similarity:169/474 - (35%) Gaps:145/474 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 FVGSMCGTLLFGLLGDRIGRIKAVVLANCC-GFLGDSATIFAET--LLTFSASRFVSGLAAEANS 193
            :.|.:...:.:|.:.|.|||...::..... ||....|::...|  |:.|   :|..||....  
  Fly    75 YAGMIISAVPWGFIADTIGRRPVLISGGWLDGFFVLCASLSQNTAQLMAF---KFFDGLIICG-- 134

  Fly   194 YLMFILVLEYVSP---------TMRSVGLNLTMCVFYGLGM------------ICASWQGVWLGS 237
              .|.:|:.|::.         .|..|||    ||..|..:            |..:...:...:
  Fly   135 --PFAVVVSYLAEFHGKKHRPYIMLFVGL----CVSIGSMILPLLSYLLLPVPILFTVSSMKFRT 193

  Fly   238 WRSFMVWTALPQLLVTGFYFLIQESAQWLVTRQDFDGAELRLRRVAKFNRRDVSEADYELFRQHC 302
            |:.|:..::.|.||....:..:.||.::|:::.::..|...|:|:.|.|:|. |...|.:  :|.
  Fly   194 WQVFLAVSSAPSLLSGFLHIFLPESPKFLMSQGNYKKALDSLQRIYKLNKRK-SRESYPI--KHL 255

  Fly   303 KTKESEARSQ--------MSMQK-----QARLIDSFKLPRLRLRLIYVTVVFSIVTL------CY 348
             |..:..||.        .::|:     |::.||.||..:......|:.:...:..|      |.
  Fly   256 -TDPTPDRSDDLDGTGRPSTLQERFSRAQSKFIDGFKQLKPMFSSPYLAISLQVYCLHFCQIMCV 319

  Fly   349 N-----------------TMSRN----------------------------------------VE 356
            |                 |:..|                                        |.
  Fly   320 NSVRLWLPQIFATMNAMDTLGANDTSMCAVLEHNANAKSMDEEEKRVECALHHDPDSYLNNITVA 384

  Fly   357 GLSISPF-VMFSLFALTLPPSGIFQTQVQKHFGRKFTSVVSMTATGLMTATTGILLAFWTQHSAT 420
            |:.:..| ::|.|..        ||. |..|..:.|..:.......|....|.::         |
  Fly   385 GIGLVGFLIIFPLMR--------FQV-VSNHILKVFLFICIFLVGSLYFVKTSLV---------T 431

  Fly   421 VMVCLLLMCRFGISVTTGSTMQISTELMPTCVRSSGLAVIHVTAAALSFISPFILHLDTYFRAAS 485
            :||..:.:...||..||  .:.:|..:.||.:|:..|.:| :|...|..:|..:| |..:.:   
  Fly   432 MMVSAVYLTMMGICATT--IIGMSVVIFPTLMRTMVLLLI-MTFGRLGSVSGNML-LPVFMQ--- 489

  Fly   486 SIITCILLLVSAWICLLLS 504
              ::|:...:  |:|.|:|
  Fly   490 --LSCLAPFL--WLCSLMS 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14856NP_650391.1 2A0119 13..514 CDD:273328 93/474 (20%)
MFS 129..503 CDD:119392 91/471 (19%)
CG14691NP_650012.2 MFS 30..>216 CDD:119392 31/151 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458445
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.