DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14856 and CG4324

DIOPT Version :9

Sequence 1:NP_650391.1 Gene:CG14856 / 41790 FlyBaseID:FBgn0038261 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_001286807.1 Gene:CG4324 / 37830 FlyBaseID:FBgn0034956 Length:478 Species:Drosophila melanogaster


Alignment Length:513 Identity:109/513 - (21%)
Similarity:191/513 - (37%) Gaps:114/513 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 EIAAIYAPFK------RPSCTRLASINMDGSNATASSEPCNRWIYHYDHGFISMNADLNWVCDD- 120
            |.||:.:|..      ..|...|.:::::..:.....:..|.:.:.:.|..:|:...|.|:.|. 
  Fly     7 EPAALPSPANLAPRDVHSSTLELKTVSINPDDTYTVQQAINAFGFGWFHVKLSLLVGLCWMSDSM 71

  Fly   121 --AYKARVGQSLF-----------------FVGSMCGTLLFGLLGDRIGRIKAVVLANCCGFLGD 166
              |..:.:|.|||                 |:|.|..:..:..|.:|.||..|:           
  Fly    72 EMAILSILGPSLFCEWNVTKFQQASVTTVVFLGMMLSSSFWTQLSNRYGRKSAL----------- 125

  Fly   167 SATIFAETLLTFSASRFVSGLAAEANSYLMFILVLEYVSPTMRSVGLNLTM------------CV 219
              |:|...|:.:|.      |::.|.||...:.:...|...:..|..::|:            ||
  Fly   126 --TLFGVLLVLYSI------LSSVAPSYAWLLTLRGLVGFAIGCVPQSVTLYAEFLPTKHKGKCV 182

  Fly   220 -----FYGLG--------MICASWQGVWLGSWRSFMVWTALPQLLVTGFYFLIQESAQWLVTRQD 271
                 |:.||        ::...:.|     ||..:..:|.|.|:.|.....:.|||::......
  Fly   183 VLMDCFWALGACFEVVLALVVYPYYG-----WRGLLALSATPLLIFTILSPWLSESARYYSYNGH 242

  Fly   272 FDGAELRLRRVAKFNRRDVSEADYELFRQHCKTKESEARSQMSMQKQARLIDSFKLPRLRLRLIY 336
            .|.|...|.::|..|:|            |.......|..:.|..:..|.:.|..|.|..:.|.:
  Fly   243 NDKAIKVLEQIAHNNKR------------HMLMGRLMADDEPSCAESFRSLLSPSLYRTTILLWF 295

  Fly   337 VTVVFSIVTLCYN---------TMSRNVEG-------LSISPFVMFSLFALTLPPSGIFQTQVQK 385
            :.:..:   .||.         .::||.|.       ...|.|:......|:..|..:...:|.|
  Fly   296 LWLASA---FCYYGLVLVTTELLVARNKESHPNECVTFMTSDFMDLLWITLSEFPGILLTIKVVK 357

  Fly   386 HFGRKFTSVVSMTATGLMTATTGILLAFWTQHSATVMVCLLLMCRFGISVTTGSTMQISTELMPT 450
            .||:|.|.|:...|..|.|.   :|::..::.|.:|   .|.:.|..||....:....:.|:.|.
  Fly   358 LFGKKKTIVLQYLALVLCTL---VLMSVESRFSTSV---TLFIARGTISGIFQAIYVYTPEIYPA 416

  Fly   451 CVRSSGLAVIHVTAAALSFISPFILH--LDTYFRAASSIITCILLLVSAWICLLLSET 506
            .:||.|::...|.|...:.::||:..  :|:....|.|....:.||.|.....|..||
  Fly   417 ALRSVGVSGCSVLARLGAMLTPFVAQVLMDSSRIQAMSTYAIVGLLASIACVFLPRET 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14856NP_650391.1 2A0119 13..514 CDD:273328 109/513 (21%)
MFS 129..503 CDD:119392 92/433 (21%)
CG4324NP_001286807.1 2A0119 10..476 CDD:273328 107/510 (21%)
MFS 60..471 CDD:119392 97/455 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458132
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.