DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14856 and CG8654

DIOPT Version :9

Sequence 1:NP_650391.1 Gene:CG14856 / 41790 FlyBaseID:FBgn0038261 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_001246441.1 Gene:CG8654 / 37275 FlyBaseID:FBgn0034479 Length:502 Species:Drosophila melanogaster


Alignment Length:551 Identity:131/551 - (23%)
Similarity:222/551 - (40%) Gaps:88/551 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DEILVKCGDSHRYQYMLLALYGLLMFIVSRHYFAQNVIGFVPDHWCYHEQLENRSYAEIAAIYAP 70
            |.|:.:.||..|||.....:..|..|....|     .:|.:                 ..|...|
  Fly    22 DPIISQIGDFRRYQLFFFFIVLLCKFGTGWH-----TLGHI-----------------FLAAPTP 64

  Fly    71 FKRPSCTRLASINMDGSNAT-ASSEPCNRWIYHYDHGFISMNADLNW--VCDDAYKARVGQSLFF 132
            .   ||..        .|.| ..|:.|:.  ..:|...........|  .|:....|.:.||:..
  Fly    65 L---SCKT--------ENVTDPCSDECSE--TEFDTSVFQSTIITEWNLTCESKQLASLSQSIVM 116

  Fly   133 VGSMCGTLLFGLLGDRIGRIKAVVLANCCGFLGDSATIFAETLLT------------FSASRFVS 185
            :|.:.|::|||:..||.||..|.:  .|| |:         .|:|            :...||:.
  Fly   117 LGILFGSILFGMFADRYGRRPAFL--TCC-FM---------QLITGLIVCVSPYYWFYCLFRFLV 169

  Fly   186 GLAAEANSYLMFILVLEYVSPTMRSVGLNLTMCVFYGLGMICASWQGVWLGSWRSFMVWTALPQL 250
            .:|........|:|::|.|.|..|.: :.:...:.:.:|....:....::..||.|.....:..:
  Fly   170 AVATAGTMTTSFVLLMEIVGPKKREM-VAILYQIPFNIGHASLALFAYFIREWRWFQFSITIFSI 233

  Fly   251 LVTGFYFLIQESAQWLVTRQDFDGAELRLRRVAKFNRRDVSEADYELFRQHCKTKESEARSQMSM 315
            :...:.:|:.||.:||.|....|.:...|.::||.|:     |..|..|...:.......::..:
  Fly   234 VFVIYIWLVPESPRWLFTTGKLDKSIKILEKIAKCNK-----APTETIRPEIEAAYGALAARQPV 293

  Fly   316 QKQARLIDSFKLPRLRLRLIYVTVVFSIVTLCYNTMSRNVEGLSISPFVMFSLFALTLPPSGIFQ 380
             |:..::|.|:.|.:|::.|::...:.:|.:.|...::.|..|..:.|:..::.|....|.....
  Fly   294 -KKGTVVDLFRTPYMRIKTIFMANNWLVVCMVYYGTAQYVSALGGNIFISNAIAAGVGIPGTCLC 357

  Fly   381 TQVQKHFGRKFTSVVS--MTATGLMTATTGILLAFWTQHSATVMVCLLLMCRFGISVTTGSTMQI 443
            ..:.|:.|||.|.::|  .:|.||      ||||..:..:..|.|....:..||.|:|..:....
  Fly   358 ALMTKYLGRKKTLLLSNGCSALGL------ILLACLSTQAEAVRVTCATIGLFGASITFPNVYLY 416

  Fly   444 STELMPTCVRSSGLAVIHVTAAALSFISPFILHLDTYFRAASSIITCILLLVSAWICLLLSETRN 508
            ..||.||.|||||:.:..:.....|.::|.|:.|..|....:.:|..|..:::....:.|.|||.
  Fly   417 GGELFPTVVRSSGVGLCSMVGRIGSIVAPLIVDLAAYGLWVAPLIFGIFSILAMLGTIFLPETRG 481

  Fly   509 KKLPLTLAEGEEFGKGERMFDFMRSFKKADQ 539
            ..||.||.:||.||:           ||.||
  Fly   482 TPLPETLEDGETFGR-----------KKKDQ 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14856NP_650391.1 2A0119 13..514 CDD:273328 119/517 (23%)
MFS 129..503 CDD:119392 91/387 (24%)
CG8654NP_001246441.1 SP 85..487 CDD:273317 102/426 (24%)
MFS 87..477 CDD:119392 95/414 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X24
33.010

Return to query results.
Submit another query.