DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14856 and Slc22a5

DIOPT Version :9

Sequence 1:NP_650391.1 Gene:CG14856 / 41790 FlyBaseID:FBgn0038261 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_062142.1 Gene:Slc22a5 / 29726 RGDID:3702 Length:557 Species:Rattus norvegicus


Alignment Length:548 Identity:121/548 - (22%)
Similarity:233/548 - (42%) Gaps:65/548 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DFDEILVKCGDSHRYQYMLLALYGLLMFIVSRHYFAQNVI--GFVPDH-------------WCYH 53
            |:||:....|:...:|.::..|  |...|:...:...:::  ...|:|             |..|
  Rat     3 DYDEVTAFLGEWGPFQRLIFFL--LSASIIPNGFNGMSIVFLAGTPEHRCLVPHTVNLSSAWRNH 65

  Fly    54 E-QLENRSYAEIAAIYAPFKRPSCT--RLASINMDGSNATA--------------SSEPC-NRWI 100
            . .||.:...::.        .||.  |||:|    :|.:|              ..|.| :.|.
  Rat    66 SIPLETKDGRQVP--------QSCRRYRLATI----ANFSALGLEPGRDVDLEQLEQENCLDGWE 118

  Fly   101 YHYDHGFISMNADLNWVCDDAYKARVGQSLFFVGSMCGTLLFGLLGDRIGR--IKAVVLANCCGF 163
            |:.|....::..:.:.||.|.:||.:..||||||.:.|:.:.|.|.||.||  :..:.:....||
  Rat   119 YNKDVFLSTIVTEWDLVCKDDWKAPLTTSLFFVGVLMGSFISGQLSDRFGRKNVLFLTMGMQTGF 183

  Fly   164 LGDSATIFAETLLTFSASRFVSGLAAEANSYLMFILVLEYVSPTMRSVGLNLTMCVFYGLGMICA 228
              ....:|:.....|:....:.|:...:|....|:|..|.:|.::|.:...|.:|:||..|.:..
  Rat   184 --SFLQLFSVNFEMFTVLFVLVGMGQISNYVAAFVLGTEILSKSIRIIFATLGVCIFYAFGFMVL 246

  Fly   229 SWQGVWLGSWRSFMVWTALPQLLVTGFYFLIQESAQWLVTRQDFDGAELRLRRVAKFNRRDVSEA 293
            .....::..||..::...:|.:|....::.|.||.:||:::.....||:.:|:.||||.......
  Rat   247 PLFAYFIRDWRMLLLALTVPGVLCGALWWFIPESPRWLISQGRVKEAEVIIRKAAKFNGIVAPST 311

  Fly   294 DYELFRQHCKTKESEARSQMSMQKQA-RLIDSFKLPRLRLRLIYVTVVFSIVTLCYNTMSRNVEG 357
            .::         .||.:...|.:.|: .:.|..:...:|:..|...:::..:::.|..:|.:...
  Rat   312 IFD---------PSELQDLNSKKPQSHHIYDLVRTRNIRIITIMSIILWLTISVGYFGLSLDTPN 367

  Fly   358 LSISPFVMFSLFALTLPPSGIFQTQVQKHFGRKFTSVVSMTATGLMTATTGILLAFWTQHSATVM 422
            |....:|...|.|....|:.:....:.:|..|::    |::|...:..:..:.:.........:.
  Rat   368 LHGDIYVNCFLLAAVEVPAYVLAWLLLQHLPRRY----SISAALFLGGSVLLFIQLVPSELFYLS 428

  Fly   423 VCLLLMCRFGISVTTGSTMQISTELMPTCVRSSGLAVIHVTAAALSFISPFILHLDTYFRAASSI 487
            ..|:::.:|||:.........:.||.||.||:.|:.|....:...|.:||:.::|..|.|....|
  Rat   429 TALVMVGKFGITSAYSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRFLPYI 493

  Fly   488 ITCILLLVSAWICLLLSETRNKKLPLTL 515
            :...|.:::|.:.|...|:....||.|:
  Rat   494 LMGSLTILTAILTLFFPESFGAPLPDTI 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14856NP_650391.1 2A0119 13..514 CDD:273328 117/536 (22%)
MFS 129..503 CDD:119392 85/376 (23%)
Slc22a5NP_062142.1 2A0119 12..520 CDD:273328 117/536 (22%)
MFS 123..510 CDD:119392 90/401 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 537..557
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347288
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57756
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X24
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.