DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14856 and T05A1.5

DIOPT Version :9

Sequence 1:NP_650391.1 Gene:CG14856 / 41790 FlyBaseID:FBgn0038261 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_001366751.1 Gene:T05A1.5 / 188077 WormBaseID:WBGene00011456 Length:359 Species:Caenorhabditis elegans


Alignment Length:245 Identity:54/245 - (22%)
Similarity:106/245 - (43%) Gaps:29/245 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 ASSEPCNRWIYHYDH-GFISMNADLNWVCDDAYKARVGQSLFFVGSMCGTLLFGLLGDRIGRIKA 154
            |.|.||.     .|: .|:::..:.|..........:..|:||:|:.....::.:..||||| :.
 Worm   108 APSSPCT-----LDNCSFVTVQNEFNITKTLIDPGEMTSSIFFLGNGILGQIYAVAADRIGR-RP 166

  Fly   155 VVLAN--CCGFLGDSATIFAETLLTFSASRFVSGLAAEANSYLMFILVLEYVSPTMRSVGLNLTM 217
            |::|:  ..|..|..|. :|.|.......||..|....|.:.:.:::..|.:|.:.....     
 Worm   167 VLIASLFISGLSGIGAA-YAPTFEIMLIGRFFQGSCFTALTMINWVMCCESISFSGHGYA----- 225

  Fly   218 CVFYGL----GMICASWQGVWLGSWRSFMVWTALPQLLVTG--FYFLIQESAQWLVTRQDFDGAE 276
            .|.:||    |....|...::..:||...:.|::|.:|. |  ..|.:.||..:||.::..|.. 
 Worm   226 SVLFGLCWVIGYCSVSPLAMYFSTWRYVQLATSVPCVLF-GILMMFTLPESFSFLVAKRKRDDL- 288

  Fly   277 LRLRRVAKFNRRDVSEADY---ELFRQHCKTKESEARSQ-MSMQKQARLI 322
              ::.:...:|....|.||   ::.....:.:::|:..| :.:..|::|:
 Worm   289 --VKWIEMASRVGNEEIDYDADQIVDMSSREEDNESLLQTLKLVLQSKLM 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14856NP_650391.1 2A0119 13..514 CDD:273328 54/245 (22%)
MFS 129..503 CDD:119392 47/206 (23%)
T05A1.5NP_001366751.1 MFS 117..>271 CDD:421695 35/161 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163077
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.