DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14856 and Y51A2D.18

DIOPT Version :9

Sequence 1:NP_650391.1 Gene:CG14856 / 41790 FlyBaseID:FBgn0038261 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_507620.2 Gene:Y51A2D.18 / 180202 WormBaseID:WBGene00013083 Length:550 Species:Caenorhabditis elegans


Alignment Length:450 Identity:106/450 - (23%)
Similarity:195/450 - (43%) Gaps:51/450 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 YDHGFISMNADLNWVCDDAYKARVGQSLFFVGSMCGTLLFGLLGDRIGRIKAVVLANCCGFLGDS 167
            :.:.|.|:|.:.|:.|:.:...:...|:...|.:.|:::||.:.|..||.....:|:....:|..
 Worm   107 FQYQFRSINVEYNYFCNTSKLVKNSISVQMFGVLTGSIVFGQISDSFGRKIGSQVASLGMLIGWL 171

  Fly   168 ATIFAETLLTFSASRFVSGLAAEANSYLMFILVLEYVSPTMRSVGLNLTMCVFYGLGMICASWQG 232
            ..:.:..||.|:.||.:.|.....:..::.:.::|.: |....:.:|  |.:.:...|...|: .
 Worm   172 IVVQSRNLLHFTISRTIVGFFTGGSISIINVFIMENI-PKKHRMWIN--MAITWSPNMPIYSY-F 232

  Fly   233 VWLGS-WRSFM---VWTALPQLLVTGFYFLIQESAQWLVTRQDFDGAELRLRRVAK-FNRRDVSE 292
            .||.| |:|..   .:..:|.:|.  |.|.|.||.:|||||.....|...|:|..| .|:.::..
 Worm   233 AWLASDWKSLAYINAFMCIPGILF--FQFFIHESPRWLVTRGKISEAVQVLQRQLKTSNQENLIH 295

  Fly   293 ADYELFRQHCKTKESEARSQMSMQKQARLIDSFKLPRLRLRLIYVTVVFSIVTLCYNTMSRNVEG 357
            .|:|   ::.:.:.::.::|.:.:.:......|..|:|.:..|.:...:...::....:..|:|.
 Worm   296 EDFE---ENLRMEYAKTQAQNTRKTKFSYYHLFVTPKLAITTIVLAYSYCATSIINYGVLFNMEK 357

  Fly   358 LSISPF---VMFSLFALTLPPSGIFQTQVQKHFGRKFTSVVSMTATGLMTATTGILL-----AFW 414
            ||.|.:   |...|.......|..:.....|..||||     :..:||:.....:.|     |..
 Worm   358 LSGSIYWNSVYTGLMRYACNLSFGYADLKFKSIGRKF-----IHTSGLVIIVLSLSLVVGSYALH 417

  Fly   415 TQHSATVMVCLLLMCRFGISVTTGSTMQI-------STELMPTCVRSSGLAVIHVTAAALSFISP 472
            ..|....::      |..|.:.:..|.||       |.||.||.:|:.|.|.:.:.......:||
 Worm   418 LNHEMKDVI------RISILLASSMTSQIYIADGIVSAELFPTPIRTIGYAFLQLWNRVGVVLSP 476

  Fly   473 FILHLDTYFRAASSIITCILLLVS-----AWICLLLSETRNKKLPLTLAEGEE--FGKGE 525
            ||.:|..|:.|   :..|.::|.|     ::.| ||.||:.:.|...:....:  ||.|:
 Worm   477 FIFYLADYWLA---LPFCFMILFSLIDTFSFEC-LLPETKGRHLVEHMPPRHQWWFGAGK 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14856NP_650391.1 2A0119 13..514 CDD:273328 103/435 (24%)
MFS 129..503 CDD:119392 93/398 (23%)
Y51A2D.18NP_507620.2 2A0119 24..519 CDD:273328 103/435 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X24
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.