DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14856 and SLC22A31

DIOPT Version :9

Sequence 1:NP_650391.1 Gene:CG14856 / 41790 FlyBaseID:FBgn0038261 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_001371692.1 Gene:SLC22A31 / 146429 HGNCID:27091 Length:446 Species:Homo sapiens


Alignment Length:439 Identity:110/439 - (25%)
Similarity:177/439 - (40%) Gaps:69/439 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 NW--VCDDAYKARVGQSLFFVGSMCGTLLFGLLGDRIGRIKAVVLAN---CCGFLGDSATIFAE- 173
            ||  ||.|.:|..:.|....:|.:.|.::.|...||.|| :||.:|:   ..| ||.|..:.|. 
Human     8 NWNLVCGDGWKVPLEQVSHLLGWLLGCVILGAGCDRFGR-RAVFVASLVLTTG-LGASEALAASF 70

  Fly   174 -TLLTFSASRFVSGLAAEANSYLMFILVLEYVSPTMR---SVGLNLTMCV----FYGLGMICASW 230
             |||..   |.:.|.........:::..||...|..|   |:|..|...|    ..||..:...|
Human    71 PTLLVL---RLLHGGTLAGALLALYLARLELCDPPHRLAFSMGAGLFSVVGTLLLPGLAALVQDW 132

  Fly   231 ---QGVWLGSWRSFMVWTALPQLLVTGFYFLIQESAQWLVTRQDFDGAELRLRRVAKFNRRDVSE 292
               ||  ||:..|.::      ||..||..|..||..||:.......|...|.|.|:.:  .|..
Human   133 RLLQG--LGALMSGLL------LLFWGFPALFPESPCWLLATGQVARARKILWRFAEAS--GVGP 187

  Fly   293 ADYELFRQHCKTKESEARSQMSM----QKQARLIDSFKLPRLR------LRLIYVTVVFSIVTLC 347
            .|..|       :|:...::::|    ..|.|......|.|.|      |.|.:.::|...:...
Human   188 GDSSL-------EENSLATELTMLSARSPQPRYHSPLGLLRTRVTWRNGLILGFSSLVGGGIRAS 245

  Fly   348 Y-NTMSRNVEGLSISPFVMFSLFALTLPPSGIFQTQVQKHFGRKFTSVVSMTATGLMTATTGILL 411
            : .:::..|....:..|:...|.|..|    :|........||:...::....|||    ..:||
Human   246 FRRSLAPQVPTFYLPYFLEAGLEAAAL----VFLLLTADCCGRRPVLLLGTMVTGL----ASLLL 302

  Fly   412 AFWTQH--SATVMVCLLLMCRFGISVTTGSTMQISTELMPTCVRSSGLAVIHVTAAALSFISPFI 474
            ....|:  ..||:...:|......:|:..|:: .:.|:.||.:|.:||.::    ....|:....
Human   303 LAGAQYLPGWTVLFLSVLGLLASRAVSALSSL-FAAEVFPTVIRGAGLGLV----LGAGFLGQAA 362

  Fly   475 LHLDTYFRAASSIITCIL---LLVSAWIC-LLLSETRNKKLPLTLAEGE 519
            ..|||........:..::   |.|.|.:| |||.|:|::.||.:|.:.:
Human   363 GPLDTLHGRQGFFLQQVVFASLAVLALLCVLLLPESRSRGLPQSLQDAD 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14856NP_650391.1 2A0119 13..514 CDD:273328 109/432 (25%)
MFS 129..503 CDD:119392 96/405 (24%)
SLC22A31NP_001371692.1 MFS 9..383 CDD:421695 97/408 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153749
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.