DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14856 and slc22a16

DIOPT Version :9

Sequence 1:NP_650391.1 Gene:CG14856 / 41790 FlyBaseID:FBgn0038261 Length:557 Species:Drosophila melanogaster
Sequence 2:XP_002936981.2 Gene:slc22a16 / 100488673 XenbaseID:XB-GENE-961385 Length:567 Species:Xenopus tropicalis


Alignment Length:558 Identity:124/558 - (22%)
Similarity:227/558 - (40%) Gaps:57/558 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDEILVKCGDSHRYQYMLLALYGLLMFIVSRHYFAQNVIGFVPDHWCYHEQ------LENRS--- 60
            ||.:    |...|:|.::.............||.|...|...|...|...:      |.|.|   
 Frog     5 FDYV----GHFGRFQALIYFSSAFQAISCGIHYLASVFIAITPKFICRAPENISSVLLPNASTLR 65

  Fly    61 YAEIAAIYAP---------------------FKRPSCTRLASINMDGSNATASSEPCNRWIYHYD 104
            ..::..::.|                     |||.: |...:.:.||:....|   |:.. |:||
 Frog    66 LEDVWELWTPKDYLVVKQENGDIWELNQCSRFKREN-TSYLTYSYDGNKTLFS---CSNG-YYYD 125

  Fly   105 HGFISMNADLNW--VCDDAYKARVGQSLFFVGSMCGTLLFGLLGDRIGRIKAVVLANCCGFLGDS 167
            :..:..:...:|  ||:..:.|::.|..|..|.:.|.::||.:.||:||...:.|.:...||...
 Frog   126 NTNLESSIVTDWHLVCEREWLAKLIQPTFMFGVLIGAVIFGDIADRVGRRLILWLTSTGQFLFGI 190

  Fly   168 ATIFAETLLTFSASRFVSGLAAEANSYLMFILVLEYVSPTMRSVGLNLTMCVFYGLGMICASWQG 232
            |..|.....:|...||:..:.:.....::|:.|.|||....|| ..::.:..|:.:|::..|..|
 Frog   191 AVAFTFDYYSFVIVRFLLAMVSSGYYVVVFVYVTEYVGIKARS-WASMHVHAFFAVGVMIVSLVG 254

  Fly   233 VWLGSWRSFMV---WTALPQLLVTGFYFLIQESAQWLVTRQDFDGAELRLRRVAKFNRRDVSEAD 294
            ..:.:|..:.:   .|.||.:|..   :::.|:..||.::......|..:..:.|:|:.......
 Frog   255 FLVRTWWMYQIILSLTTLPFVLCC---WMLPETPFWLYSQGKHKEVEKLIGTIEKWNKISTPCKL 316

  Fly   295 YELFRQHCKTKESEARSQMSMQKQARLIDSFKLPRLRLRLIYVTVVFSIVTLCYNTMSRNVEGLS 359
            .||    |..:|:: :::|...|:..::|.|.......|.:.|.:::...:|.|...:.|...|.
 Frog   317 SEL----CSVQETQ-KTEMDTLKKHSVLDLFYNWSFARRTVTVWLIWFTGSLGYYVFALNSVNLG 376

  Fly   360 ISPFVMFSLFALTLPPSGIFQTQVQKHFGRKFTSVVSMTATGLMTATTGILLAFWTQHSATVMVC 424
            .:.::...|.:....||.|.........||:.|....:.   |.....||::.....|| ||.:.
 Frog   377 GNEYLNLFLTSAVEIPSYIVACFGMDKIGRRNTLAPFLI---LSAVICGIIMLIPQDHS-TVTIA 437

  Fly   425 LLLMCRFGISVTTGSTMQISTELMPTCVRSSGLAVIHVTAAALSFISPFILHLDTYFRAASSIIT 489
            :.:..:|.|:|..|.....:.||.||.|||..:....:.....|.::||.::|...:.....::.
 Frog   438 MSMGGKFSIAVAFGLIYLYTAELYPTIVRSLAVGSGSMMCRIGSVVAPFCVYLTDVWIFMPQMLV 502

  Fly   490 CILLLVSAWICLLLSETRNKKLPLTLAEGEEFGKGERM 527
            .|:..::..:.|.|.||....|..|:.|..|.|...|:
 Frog   503 GIMAFLTGVLTLKLPETLGVPLTSTIEEAAEMGTNNRI 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14856NP_650391.1 2A0119 13..514 CDD:273328 117/535 (22%)
MFS 129..503 CDD:119392 84/376 (22%)
slc22a16XP_002936981.2 MFS_SLC22A16_CT2 111..517 CDD:340933 95/422 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X24
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.