DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14856 and zmp:0000001102

DIOPT Version :9

Sequence 1:NP_650391.1 Gene:CG14856 / 41790 FlyBaseID:FBgn0038261 Length:557 Species:Drosophila melanogaster
Sequence 2:XP_001340340.6 Gene:zmp:0000001102 / 100000058 ZFINID:ZDB-GENE-140106-62 Length:560 Species:Danio rerio


Alignment Length:592 Identity:157/592 - (26%)
Similarity:259/592 - (43%) Gaps:84/592 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAMDFDEILVKCGDSHRYQYMLLALYGLLMFIVSRHYFAQNVIGFVPDHWCYHEQLE-----NRS 60
            :.|.||.||.:.....|||..|:.|..:....:..|:...|.|..:|.|.|....|:     |.:
Zfish     9 VTMKFDNILDETDGFGRYQIALVMLLFIPRITIPCHFLLNNFIAAIPSHHCDISSLDADGLGNLT 73

  Fly    61 YAEIAAIYAPFKR----PSCTRLAS------INMDGSNATASSEPCNRWIYHYDHG-FIS-MNAD 113
            ..|...:..|.:.    .||...|.      ||...|:|....|..|.|  |:|:. ||| :...
Zfish    74 QKERLIVSVPAQEDGTPASCHMFAHPQFQLLINSSSSSALPVVECQNGW--HFDNSTFISTLATQ 136

  Fly   114 LNWVCDDAYKARVGQSLFFVGSMCGTLLFGLLGDRIGRIKAVVLANCCGFLGDSATIFAETLLTF 178
            .:.|||....|:...::||||.|||.:.||:|.|:.||...::::.....:....:.|:.:.:.|
Zfish   137 FDLVCDKRGLAKASATIFFVGVMCGAVFFGVLCDKYGRRSMLLVSYVFSIVFSVTSAFSSSYIMF 201

  Fly   179 SASRFVSGLAAEANSYLMFILVLEYVSPTMRS-VGLNLTMCVFYGLGMICASWQGVWLGSWRSFM 242
            :|.||::|||....|.:..:|.:|:|....|: :||..:|.  :.:|.:..:.....:..||..:
Zfish   202 AAFRFLTGLALTGISNISVVLSIEWVDTKHRTFMGLFGSMS--WSIGNMLLAGFAFMVTDWRLLI 264

  Fly   243 VWTALPQLLVTGFYFLIQESAQWLVTRQDFDGAELRLRRVAKFNRR-------------DVSEAD 294
            |....|..|.|..::.|.:||:||:.....:.|...|.:.|.||:|             .|...|
Zfish   265 VIVTAPLFLATATWWWIPDSARWLIANGKTETAYKYLHKCATFNKRLDFTSRVKPETLSTVVTVD 329

  Fly   295 YELFRQHCKTKESEARSQMSMQKQARLIDSFKLPRLRLRLIYVTVVFSIVTLCYNTMSRNVEGLS 359
            :   |.|..|                .:|..|.|:||...::..:|:..|...|..:|.|:.|..
Zfish   330 H---RGHSYT----------------YLDLVKTPQLRKLTLFTGIVWYGVASTYYGISLNITGFG 375

  Fly   360 ISPFVMFSLFALTLPPSGIFQTQVQKHFGRKFTSVVSMTATG------LMTATTGILLAFWTQHS 418
            :.|::...::|....|:.|.........||:.|...::..||      ::|.|     .:||  .
Zfish   376 LDPYLTHFIYAAIEVPAKILVYFSLNKVGRRNTQTGTLVLTGFCILINIITPT-----EYWT--F 433

  Fly   419 ATVMVCLLLMCRFGISVTTGSTMQI-STELMPTCVRSSGLAVIHVTAAALSFISPFILHLDTYFR 482
            .||:..|    ..|:|..:.:|:.: :|||.||.:|.:||...:..|...:.|||.|:.|:..::
Zfish   434 RTVIAVL----GKGLSEASFTTVILYTTELYPTVMRQNGLGFTNFMARMGASISPLIMLLEDIWK 494

  Fly   483 AASSIITCILLLVSAWICLLLSETRNKKLPLTLAEGEEFGKGERMFDFMRSFKKADQH------D 541
            ....:|.|.:.:....|.|||.||.|..||.|:.:.|:..| :.::     |..|||.      .
Zfish   495 LLPEVIFCSMAIFCGIIALLLPETNNASLPETVEDIEDMRK-KPVY-----FTTADQSAMPLKLP 553

  Fly   542 LSADTIE 548
            |:|||.:
Zfish   554 LTADTTQ 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14856NP_650391.1 2A0119 13..514 CDD:273328 141/538 (26%)
MFS 129..503 CDD:119392 100/394 (25%)
zmp:0000001102XP_001340340.6 Sugar_tr 22..526 CDD:331684 141/537 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D284622at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X24
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.