DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14855 and GIT1

DIOPT Version :9

Sequence 1:NP_650390.2 Gene:CG14855 / 41789 FlyBaseID:FBgn0038260 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_010022.1 Gene:GIT1 / 850462 SGDID:S000000695 Length:518 Species:Saccharomyces cerevisiae


Alignment Length:215 Identity:50/215 - (23%)
Similarity:76/215 - (35%) Gaps:59/215 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 CNRWIYKYDF-----GYKSMNTELNWVCDEAYKARVGQSLFFVG--SVCGTLAFGLLGDRIGRIR 151
            |..| :.|||     |..|.....:.:.|:....:|.:....:|  :|.|......|.|||||..
Yeast   273 CGTW-FMYDFVTFPNGIFSSTIISSVIKDQNDLVKVAEWNLLLGVLAVLGVPIGAYLSDRIGRKY 336

  Fly   152 ALILANWCGFLGDFSTIFAGSLTSFSISRFISGLAADANSYLMYILILEYVSPS-LRNVG----- 210
            .|:.    ||.|            :.|...|.|.|.|....:..:.|:.|...: |.|.|     
Yeast   337 TLMF----GFSG------------YIIFGLIIGCAYDQLKKITPLFIIFYAFMNMLGNAGPGDML 385

  Fly   211 --------LNTVLGSFYCL----GLIGA-----CWLAV-------WVGHWRIFLACSSVPLLLVT 251
                    ...|.|.||.|    |.||:     |:..:       |.     |:..:...|:.:.
Yeast   386 GVISSEASATAVRGVFYGLSAVTGKIGSVVGVECFQPIRDNLGARWT-----FIIAAICGLIGII 445

  Fly   252 LFYFLVQESAQWLVTRNDVD 271
            :.||.|..|.:..:.:.||:
Yeast   446 ITYFFVPHSLESDLMKQDVE 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14855NP_650390.2 2A0119 11..507 CDD:273328 50/215 (23%)
MFS 127..499 CDD:119392 41/177 (23%)
GIT1NP_010022.1 MFS_PhT 48..454 CDD:340922 47/202 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.