DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14855 and OCT5

DIOPT Version :10

Sequence 1:NP_650390.2 Gene:CG14855 / 41789 FlyBaseID:FBgn0038260 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_178059.1 Gene:OCT5 / 844279 AraportID:AT1G79410 Length:515 Species:Arabidopsis thaliana


Alignment Length:79 Identity:20/79 - (25%)
Similarity:30/79 - (37%) Gaps:23/79 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SNEIVENQMSAIKSAAESNNFSLLLKLVSPSVFELEDGERVRKAFFSAKLLLMDSKFERPGIVAT 84
            :||...:.|.....:|.:         :||:    |||:..|....|.||   .|:.|       
plant   362 NNETANSMMQKFWDSAMA---------LSPN----EDGDETRSEEESMKL---SSEIE------- 403

  Fly    85 VTESGKYTSQIRMK 98
            ||:|..|.:....|
plant   404 VTKSFSYPNTFAFK 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14855NP_650390.2 2A0119 11..507 CDD:273328 20/79 (25%)
OCT5NP_178059.1 MFS_OCT_plant 83..488 CDD:340936 20/79 (25%)

Return to query results.
Submit another query.