DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14855 and T05A1.5

DIOPT Version :9

Sequence 1:NP_650390.2 Gene:CG14855 / 41789 FlyBaseID:FBgn0038260 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001366751.1 Gene:T05A1.5 / 188077 WormBaseID:WBGene00011456 Length:359 Species:Caenorhabditis elegans


Alignment Length:206 Identity:52/206 - (25%)
Similarity:88/206 - (42%) Gaps:30/206 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 SLFFVGS-VCGTLAFGLLGDRIGRIRALILANWCGFLGDFSTIFAGSLTSFSISRFISGLAADAN 190
            |:||:|: :.|.: :.:..|||||...||.:.:...|......:|.:.....|.||..|....|.
 Worm   142 SIFFLGNGILGQI-YAVAADRIGRRPVLIASLFISGLSGIGAAYAPTFEIMLIGRFFQGSCFTAL 205

  Fly   191 SYLMYILILEYVSPSLRNVGLNTVLGSFYCLGLIGACW---------LAVWVGHWRIFLACSSVP 246
            :.:.:::..|.:|.|          |..|...|.|.||         ||::...||.....:|||
 Worm   206 TMINWVMCCESISFS----------GHGYASVLFGLCWVIGYCSVSPLAMYFSTWRYVQLATSVP 260

  Fly   247 LLLV-TLFYFLVQESAQWLVTRNDVDGAIRRLERVAKINRRQVADKDFKDFRIYCEQHYRKDKNQ 310
            .:|. .|..|.:.||..:||.:...|..::.:|..:::...:: |.|       .:|.......:
 Worm   261 CVLFGILMMFTLPESFSFLVAKRKRDDLVKWIEMASRVGNEEI-DYD-------ADQIVDMSSRE 317

  Fly   311 EEHAKLLDMLK 321
            |::..||..||
 Worm   318 EDNESLLQTLK 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14855NP_650390.2 2A0119 11..507 CDD:273328 52/206 (25%)
MFS 127..499 CDD:119392 52/206 (25%)
T05A1.5NP_001366751.1 MFS 117..>271 CDD:421695 37/139 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163076
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.