DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14855 and SLC22A31

DIOPT Version :9

Sequence 1:NP_650390.2 Gene:CG14855 / 41789 FlyBaseID:FBgn0038260 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001371692.1 Gene:SLC22A31 / 146429 HGNCID:27091 Length:446 Species:Homo sapiens


Alignment Length:436 Identity:115/436 - (26%)
Similarity:177/436 - (40%) Gaps:58/436 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 NW--VCDEAYKARVGQSLFFVGSVCGTLAFGLLGDRIGR----IRALILANWCGFLGDFSTIFAG 171
            ||  ||.:.:|..:.|....:|.:.|.:..|...||.||    :.:|:|....|    .|...|.
Human     8 NWNLVCGDGWKVPLEQVSHLLGWLLGCVILGAGCDRFGRRAVFVASLVLTTGLG----ASEALAA 68

  Fly   172 SLTSFSISRFISGLAADANSYLMYILILEYVSPSLR-----NVGLNTVLGSFYCLGLIGACWLAV 231
            |..:..:.|.:.|.........:|:..||...|..|     ..||.:|:|:....|      ||.
Human    69 SFPTLLVLRLLHGGTLAGALLALYLARLELCDPPHRLAFSMGAGLFSVVGTLLLPG------LAA 127

  Fly   232 WVGHWRIFLACSSVPLLLVTLFY---FLVQESAQWLVTRNDVDGAIRRLERVAKINRRQVADKDF 293
            .|..||:.....::...|:.||:   .|..||..||:....|..|.:.|.|.|:.:.....|...
Human   128 LVQDWRLLQGLGALMSGLLLLFWGFPALFPESPCWLLATGQVARARKILWRFAEASGVGPGDSSL 192

  Fly   294 KDFRIYCEQHYRKDKN-QEEHAKLLDMLKTPRMRST-------AFKLLLIFIIIVPCYNTIARNV 350
            ::..:..|......:: |..:...|.:|:|   |.|       .|..|:...|......::|..|
Human   193 EENSLATELTMLSARSPQPRYHSPLGLLRT---RVTWRNGLILGFSSLVGGGIRASFRRSLAPQV 254

  Fly   351 EGLGISPFIMFSLNALTLPPSGYLQGLLQDRMGRKATAVGWMAITGIFAVAAGLVISQGSNR--- 412
            ....:..|:...|.|..|.   :|. |..|..||:...:....:||:    |.|::..|:..   
Human   255 PTFYLPYFLEAGLEAAALV---FLL-LTADCCGRRPVLLLGTMVTGL----ASLLLLAGAQYLPG 311

  Fly   413 -NVLLLVGLTMAARFGVSIADGASSQFSTELIPTSVRGRGVAVVHVAGFAASFLSPY-ILH--LG 473
             .||.|..|.:.|...||   ..||.|:.|:.||.:||.|:.:|..|||......|. .||  .|
Human   312 WTVLFLSVLGLLASRAVS---ALSSLFAAEVFPTVIRGAGLGLVLGAGFLGQAAGPLDTLHGRQG 373

  Fly   474 TYYKPAPSIILGLLFLSGAYVC-LLLPETRNKKLPMSLAEGEEFGR 518
            .:.:......|.:|    |.:| |||||:|::.||.||.:.:...|
Human   374 FFLQQVVFASLAVL----ALLCVLLLPESRSRGLPQSLQDADRLRR 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14855NP_650390.2 2A0119 11..507 CDD:273328 110/423 (26%)
MFS 127..499 CDD:119392 100/399 (25%)
SLC22A31NP_001371692.1 MFS 9..383 CDD:421695 99/397 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153748
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.