DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7362 and pkmb

DIOPT Version :9

Sequence 1:NP_650388.2 Gene:CG7362 / 41787 FlyBaseID:FBgn0038258 Length:793 Species:Drosophila melanogaster
Sequence 2:XP_005163170.3 Gene:pkmb / 445094 ZFINID:ZDB-GENE-040801-230 Length:605 Species:Danio rerio


Alignment Length:432 Identity:154/432 - (35%)
Similarity:221/432 - (51%) Gaps:93/432 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TSIICTIGPSSSQPEVLLNLIHAGMKVVRLDFSDGTHDCHCQAIQAARKAIAMYAEETGLPRSLA 99
            |.|:||:||:|...|.|..:|.:||.|.||:||.|||:.|.:.|::.|:||..:...|...|.:|
Zfish   119 TGIVCTLGPASRSLETLREMILSGMNVARLNFSHGTHEYHAETIKSVREAIESFGAGTIDYRPVA 183

  Fly   100 IALDTKGPVI------------------------------------------------------- 109
            ||||||||.|                                                       
Zfish   184 IALDTKGPEIRTGLIKGSGTEEVKLVKGNIIKLTLDDKFMDNCDENTLWLDYKNITKVVQQGSHI 248

  Fly   110 -----------------------------------NPQGVAADLNAITEQDKLDLKFGADQKVDM 139
                                               |..|...||.|::|:|..||:||.:|.|||
Zfish   249 YVDDGLISLKVKEIGSDFLNCEIENGGMLGSKKGVNLPGANVDLPAVSEKDIKDLQFGVEQGVDM 313

  Fly   140 IFASFIRDAKALKEIRQALGACPSSEHIKIISKIESQQALANIDEIIRESDGIMVALGNMGNEIA 204
            :||||||.|..:..:|:.||  ...:.|:||||:|:.:.:...|||:..|||||||.|::|.||.
Zfish   314 VFASFIRKAADVHAVRKVLG--EKGKDIRIISKLENHEGVRKFDEILEASDGIMVARGDLGIEIP 376

  Fly   205 LEAVPLAQKSIVAKCNKVGKPVICANQMMNSMITKPRPTRAESSDVANAILDGCDALVLSDETAK 269
            .|.|.||||.::::||::|||:|||.||:.|||.|||||||||||||||:|||.|.::||.||||
Zfish   377 TEKVFLAQKMMISRCNRIGKPIICATQMLESMIKKPRPTRAESSDVANAVLDGADCIMLSGETAK 441

  Fly   270 GKYPVQCVQCMARICAKVESVLWYESIQNNLKSEVRINAADHISAVSTAIAEAATVSQAQAIVVA 334
            |:||::.|.....|..:.|:.:::..:...|:....: ..|...:|:....||:....|.||:..
Zfish   442 GEYPIESVLTQHLIAREAEAAMFHRQLFEELRRTSHL-TRDPTESVAVGAVEASFKCCASAIICL 505

  Fly   335 SPCSIVSQMVSQMRPPCPIVLLTGCPHEAAQSLLFRGVYPLL 376
            :.....:|::|:.||..||:.:|.....:.|..|:|||.|:|
Zfish   506 TKTGRSAQLLSRYRPRAPIMAVTRNGQTSRQLHLYRGVIPIL 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7362NP_650388.2 Pyruvate_Kinase 35..407 CDD:304951 154/432 (36%)
pyruv_kin 35..391 CDD:273424 154/432 (36%)
pkmbXP_005163170.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D219692at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100258
Panther 1 1.100 - - O PTHR11817
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.