DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7362 and CG12229

DIOPT Version :9

Sequence 1:NP_650388.2 Gene:CG7362 / 41787 FlyBaseID:FBgn0038258 Length:793 Species:Drosophila melanogaster
Sequence 2:NP_648980.1 Gene:CG12229 / 39945 FlyBaseID:FBgn0036723 Length:571 Species:Drosophila melanogaster


Alignment Length:382 Identity:86/382 - (22%)
Similarity:146/382 - (38%) Gaps:107/382 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LIHAGMKVVRLDFSDGTHDCHCQAIQAARKAIAMYAEETGLPRSLAIALDTKGPVINPQGVAADL 118
            :|.||: |...||.:....||                          |||   |.:.|     ||
  Fly   224 IIDAGL-VASYDFIELPRQCH--------------------------ALD---PDLYP-----DL 253

  Fly   119 NAITEQDKLDLKFGADQKVDMIFASFIRDAKALKEIRQALGACPSSEHIKIISKIESQQALANID 183
            .      ..||:..|....:.:....||....|:.:||.|.   |..::|:|..|:.:...:|:.
  Fly   254 Y------MKDLEMAASLNANYVVLPKIRCKSFLRAVRQTLN---SDFNLKLIGMIDFEYVRSNML 309

  Fly   184 E---IIRESDGIMVA-LGNMG----NEIALEAVPLAQKSIVAKCNKVGKPVICANQMMNSMITKP 240
            :   ||:..|.|.:. :.|:.    |.|..:.:|::|      |.|  ||||....:......| 
  Fly   310 DLLGIIKLVDYIWIPDMFNVNCCVYNYIMEDVLPISQ------CQK--KPVIGTVPLERCSDFK- 365

  Fly   241 RPTRAESSDVANAILDGCDALVLSDETAKGKYPVQCVQCMARICAKVESVLWYE--SIQNN--LK 301
               |.|..|    .|...||:.:.......|||:        |..|:..:..|.  ::||.  ||
  Fly   366 ---RFELHD----FLWKVDAIHIQKSPWCNKYPL--------IVKKLMPIKDYRVGAVQNKMVLK 415

  Fly   302 SEVRINAADHISAVSTAIAEAATVSQAQAIVVASPCSIVSQMVSQMRPPCPIVLLT--------- 357
            |.:    ..:.:.|:..|...::: :.|||.:.:.|...|..:|::...||:.::.         
  Fly   416 SIL----TSYQTIVNFIIRTISSI-ECQAIFLFTTCETASVALSRIEIYCPVYVMVPLEETDDAE 475

  Fly   358 --GCPHEAAQSL-LFRGVYPLL----VKEMVYGSVNYCRIMQSGLKILAKLDILKAG 407
              .|..|.|::| |.|.::|:|    :.|..|..:.:      |:..:.|...|:.|
  Fly   476 TITCKVELARALHLRRNMHPVLYTKDLNECSYSPIEF------GVDFMRKKGCLEVG 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7362NP_650388.2 Pyruvate_Kinase 35..407 CDD:304951 85/380 (22%)
pyruv_kin 35..391 CDD:273424 82/364 (23%)
CG12229NP_648980.1 pyruv_kin 103..530 CDD:273424 86/382 (23%)
Pyruvate_Kinase 126..530 CDD:304951 86/382 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0469
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11817
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.