DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smp-30 and yellow-e

DIOPT Version :9

Sequence 1:NP_001262580.1 Gene:smp-30 / 41786 FlyBaseID:FBgn0038257 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_524344.1 Gene:yellow-e / 41653 FlyBaseID:FBgn0041711 Length:530 Species:Drosophila melanogaster


Alignment Length:305 Identity:62/305 - (20%)
Similarity:107/305 - (35%) Gaps:75/305 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SYAALGEGPHWDVDRQSLYYVDLESAGINRYDFK-----QNKVYRAKIEGEIFASFILP--VENK 71
            |.|..|:.|..:.      :.|...:...|.||.     ...|||.::: .....::|.  :...
  Fly    86 SKAQFGDSPTLNA------FPDWTFSNTGRSDFNCSDLILTSVYRLRVD-SCNRIWLLDAGISRS 143

  Fly    72 PQEFAVGCGLRTVIVQWDGVSAVAKVTRTLFEVQPDL--KENRLNDAKTDPNGRFYGGTMADSGD 134
            .:::.:.|..:.::|.    .|..:|.|.: :..|::  .|:...:...|..      |.....|
  Fly   144 LEDYEITCPPKILVVD----LATDRVVRRI-DFPPEVLRGESLFTNMVIDET------TAKGCDD 197

  Fly   135 IFTQWKGELYSWQAGGQPNAIRSKVGISNGLAWDVKAKKFY----FIDTNNHE--------VLAY 187
            :|......:       :|..|....|  ..:.|.|.....|    |..:..||        |:..
  Fly   198 VFVYITDTV-------EPGIIVYDSG--KDVTWRVSHPAMYPDPDFAQSEIHEHRFVLMDGVVGL 253

  Fly   188 DYNQSTGAV-----SNPKVIFDLRKIRPEGPLFPDGMTVD--------TDG-NIYVATFNGGTVF 238
            .:::.||.|     :..:|....:.:...||| |||..:|        :.| .:.|:.|:...:|
  Fly   254 TFDERTGVVYFQPLATDRVFSVHKNVLRAGPL-PDGKMLDVKLVGKKSSQGIGLAVSPFDSSLIF 317

  Fly   239 KVNPSTGKILLEIKI----PTTQITSV-AFGGPNLDILYVTTANK 278
              :|     |.|..|    |||...|| ||....|..:...|..|
  Fly   318 --SP-----LSETAIASWNPTTNQQSVLAFDRDQLQFVADITTTK 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smp-30NP_001262580.1 SGL 18..277 CDD:285626 59/298 (20%)
NHL 168..>248 CDD:302697 22/105 (21%)
NHL repeat 168..208 CDD:271320 10/56 (18%)
yellow-eNP_524344.1 MRJP 120..393 CDD:281074 54/265 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.