DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smp-30 and yellow-e2

DIOPT Version :9

Sequence 1:NP_001262580.1 Gene:smp-30 / 41786 FlyBaseID:FBgn0038257 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_650289.2 Gene:yellow-e2 / 41652 FlyBaseID:FBgn0038151 Length:435 Species:Drosophila melanogaster


Alignment Length:101 Identity:23/101 - (22%)
Similarity:33/101 - (32%) Gaps:30/101 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 KIRPEGPLFPDGMTVDTDGNIYVATFNGGTVFKVNPSTGKILLEIKIPTTQITSVAFG-GPNLDI 270
            :..|:.|:     .:|.|  :|... |||.                 |...:||..|| |....:
  Fly    68 RYNPDSPI-----PIDID--VYYPP-NGGP-----------------PRHFVTSPRFGQGVPFSL 107

  Fly   271 LYVTTANKFD----QPKPAGTTFQVTGLNAKGYAGV 302
            .|||...:.:    |..|:.......|.|..|...|
  Fly   108 GYVTNVQRENGSEIQAYPSYQWHSSHGANCDGLTSV 143

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
smp-30NP_001262580.1 SGL 18..277 CDD:285626 17/70 (24%)
NHL 168..>248 CDD:302697 8/40 (20%)