DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smp-30 and yellow-e3

DIOPT Version :9

Sequence 1:NP_001262580.1 Gene:smp-30 / 41786 FlyBaseID:FBgn0038257 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_650288.1 Gene:yellow-e3 / 41651 FlyBaseID:FBgn0038150 Length:409 Species:Drosophila melanogaster


Alignment Length:221 Identity:43/221 - (19%)
Similarity:70/221 - (31%) Gaps:68/221 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTQMSYKVE---AVPDSYAALGEGPH------------WDVDRQSLYYVDLESAGINRYDFKQNK 50
            :|..|:::|   ..|.....||...:            .:|:.:.||:..|.|       |.:.:
  Fly   206 LTGRSWRIEHESMKPSPLLRLGRSSNSQAGIFTVSLSPSEVEDRFLYFHTLNS-------FNEMR 263

  Fly    51 VYRAKIEGEIF----------------ASFILPVENKPQEFAVGCGLRTV--IVQWDGVSAVAKV 97
            |..:.|..|.|                .......|...|...:.|.|.::  :|:|:  .:|:..
  Fly   264 VPLSLINNETFWKSANASRDSFHSLGTRGIQCESEVMDQSGNLYCSLISLGALVKWE--ESVSNY 326

  Fly    98 TRTLFEVQPDLKENRLNDAKTDPNGRFYGGTMADSGDIFTQWKGELYSWQAGGQPNAIRSKVGIS 162
            |      ..||:....|..|.    :|..|...:...     |||...|....||...       
  Fly   327 T------ADDLRVVAYNPHKI----KFVTGLKINRNS-----KGEEELWALSSQPKLF------- 369

  Fly   163 NGLAWDVKAK--KFYFIDTNNHEVLA 186
              :..|:.|.  ||..|.....::||
  Fly   370 --VGGDLPANEVKFQIIGCRTADLLA 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smp-30NP_001262580.1 SGL 18..277 CDD:285626 39/201 (19%)
NHL 168..>248 CDD:302697 7/21 (33%)
NHL repeat 168..208 CDD:271320 7/21 (33%)
yellow-e3NP_650288.1 MRJP 110..397 CDD:281074 43/221 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.