DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smp-30 and yellow-g

DIOPT Version :10

Sequence 1:NP_001262580.1 Gene:smp-30 / 41786 FlyBaseID:FBgn0038257 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_523888.1 Gene:yellow-g / 38294 FlyBaseID:FBgn0041709 Length:393 Species:Drosophila melanogaster


Alignment Length:177 Identity:44/177 - (24%)
Similarity:65/177 - (36%) Gaps:55/177 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 KGELYS-------W--QAGGQPNAIRSKVGIS---NGLAW--DVK------------AKKFYFID 178
            |||..:       |  |..|...|::|.|.|:   |||.|  ||.            :.|...|:
  Fly   112 KGECLTKIAPYPCWAIQEEGNCQALQSVVDIAVDQNGLLWALDVGIVNTLEQPIRRCSPKIVAIN 176

  Fly   179 TNNHEVL-AYDYNQSTGAVSNPK-VIFDLRKIRPEGPLFPDGMTVDTDGNIYVATFNGGTVFKVN 241
            |.||:|: :.|.:....:.|..: ::.|..|              |....:|||.....::. |.
  Fly   177 TANHKVVKSIDLSDLVTSESRLQFIVVDYSK--------------DNKPFVYVADAGARSIL-VY 226

  Fly   242 PSTGKILLEIKIPTTQITSVAFGGPNLDILYVTTANKFDQPKPAGTT 288
            ..||.....|.:|...       .|..|:|||...:     ||.||:
  Fly   227 DITGNKSYRIVLPKAT-------APTSDVLYVALTS-----KPDGTS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smp-30NP_001262580.1 SGL 18..277 CDD:462480 40/164 (24%)
yellow-gNP_523888.1 MRJP 137..391 CDD:308585 37/152 (24%)

Return to query results.
Submit another query.