DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smp-30 and yellow-d2

DIOPT Version :9

Sequence 1:NP_001262580.1 Gene:smp-30 / 41786 FlyBaseID:FBgn0038257 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_611788.1 Gene:yellow-d2 / 37704 FlyBaseID:FBgn0034856 Length:412 Species:Drosophila melanogaster


Alignment Length:303 Identity:56/303 - (18%)
Similarity:101/303 - (33%) Gaps:125/303 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 FAVGCGLRTVIVQWDGVSAVAKVTRTLF-----EVQ---PDLKENRLNDAKTDPNGRFYGGTMAD 131
            |.|.|        |..::|.|:...::|     |::   |..::..|.|...||     |..:..
  Fly     7 FGVCC--------WCWLAASAQALESVFGAYNLELEFPSPQERQRALRDGLYDP-----GSVIPI 58

  Fly   132 SGDIFTQWKGELYSWQAGGQPNAI-----RSKVGISNGLAWDVKAKKFYFIDTNNHEVL----AY 187
            ..|::         ::.|....:|     |...|:...||:.....:      .|..:|    :|
  Fly    59 DVDVY---------YKHGDATPSIFVTIPRFAKGVPYSLAYVTNEMR------PNGTLLQAYPSY 108

  Fly   188 DYNQSTGAVSNPKVIFDLRKIRPEGPLFPDGMT------VDTDGNIYVATFNGGTV--------- 237
            ::::|.||..|                   |:|      :|..|.:::  .:.|.:         
  Fly   109 EWHKSHGADCN-------------------GLTSVYRTQIDECGRMWI--LDSGEIDFIQHCPPQ 152

  Fly   238 -FKVNPSTGKILLEIKIP--------TTQIT-SVAFGGPNLDILYVTTA---------------- 276
             :.::..:||:..:.|:|        :..:| :|.....|.|:.:|..|                
  Fly   153 LYAIDLESGKVAHQYKMPKRLYKEGVSRFVTPTVELDPHNCDVGFVYMADSIGDGIVVYDVAAQQ 217

  Fly   277 -----NKFDQPKP-------AGTTFQV------TGLNAKGYAG 301
                 |||..|.|       ||.:||:      |.|...|..|
  Fly   218 SWRIENKFTYPHPDFGTFTIAGESFQLWDGTVSTTLTPHGLGG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smp-30NP_001262580.1 SGL 18..277 CDD:285626 43/264 (16%)
NHL 168..>248 CDD:302697 14/99 (14%)
NHL repeat 168..208 CDD:271320 7/43 (16%)
yellow-d2NP_611788.1 MRJP 122..411 CDD:281074 27/141 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.