DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smp-30 and yellow-c

DIOPT Version :9

Sequence 1:NP_001262580.1 Gene:smp-30 / 41786 FlyBaseID:FBgn0038257 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001285947.1 Gene:yellow-c / 34879 FlyBaseID:FBgn0041713 Length:438 Species:Drosophila melanogaster


Alignment Length:243 Identity:52/243 - (21%)
Similarity:84/243 - (34%) Gaps:96/243 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DVDRQS-----LYYVDLESAGINRYDFKQNKVYRAKIEGEIFASFILPVENKPQEFAVGCGLRTV 84
            |.||..     .|..||.:.|:..|..:.:|.||.|   ..|..|. |:..   :|.||    .|
  Fly   216 DADRSECQDAFAYIPDLGAYGVIVYSLRNDKSYRVK---HNFFHFD-PLHG---DFNVG----GV 269

  Fly    85 IVQW-DGVSAVAKVTRTLFEVQPD------------LKE----NRL--NDAKTDPNGRFY----- 125
            ..|| |||..:|     :..:.||            .||    ||:  |::.......:|     
  Fly   270 NFQWTDGVFGLA-----VGPMNPDHSKDIYFHALASTKEFKVSNRVLQNESHVTAGDSYYDFKYV 329

  Fly   126 ---GGTMADSGDIFTQWKGELYSWQAGGQPNAIRSKVGISNGLAWDVKAKKFY------FIDTNN 181
               |.....:.::|....|.::..|.        :|..|:   .|::  |:.|      .||:::
  Fly   330 GDRGMNGQSTAEVFDPETGVIFYTQV--------NKDAIA---CWNI--KRPYTPDTQGLIDSDS 381

  Fly   182 HEVLAYDYNQSTGAVSNPKVIFDLRKIRPEGPLFPDGMTVDTDGNIYV 229
            |.:                             :||:.|.:|.:|.|:|
  Fly   382 HTL-----------------------------VFPNDMKIDNEGTIWV 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smp-30NP_001262580.1 SGL 18..277 CDD:285626 52/243 (21%)
NHL 168..>248 CDD:302697 12/68 (18%)
NHL repeat 168..208 CDD:271320 5/45 (11%)
yellow-cNP_001285947.1 MRJP 148..436 CDD:281074 52/243 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.