DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smp-30 and y

DIOPT Version :9

Sequence 1:NP_001262580.1 Gene:smp-30 / 41786 FlyBaseID:FBgn0038257 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_476792.1 Gene:y / 30980 FlyBaseID:FBgn0004034 Length:541 Species:Drosophila melanogaster


Alignment Length:308 Identity:55/308 - (17%)
Similarity:93/308 - (30%) Gaps:112/308 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VEAVPDSYAA-----LGEGPHWDVDRQSLYYVDLESAGINRYDFKQNKVYRAKIEGEIFASFILP 67
            |:..|:::.|     :|:    :.|....|:.|....|:..|.::.||.:|.......|      
  Fly   173 VDTNPNTFIANIAVDIGK----NCDDAYAYFADELGYGLIAYSWELNKSWRFSAHSYFF------ 227

  Fly    68 VENKPQEFAVGCGLRTVIVQW--DGVSAVAKVT------RTL----------FEVQPDL--KENR 112
                |........:..:..||  :|:..::...      |||          |.|...:  .|.|
  Fly   228 ----PDPLRGDFNVAGINFQWGEEGIFGMSLSPIRSDGYRTLYFSPLASHRQFAVSTRILRDETR 288

  Fly   113 LNDAKTD--------PNGRFYGGTMADSGDIFTQWKGELYSWQAGGQPNAIRSKVGISNGLAWDV 169
            ..|:..|        ||.......|:|.|                                    
  Fly   289 TEDSYHDFVALDERGPNSHTTSRVMSDDG------------------------------------ 317

  Fly   170 KAKKFYFIDTNN----HEVLAYDYNQSTGAVSNPKVIFDLRKIRPEGPLFPDGMTVDTDGNIYVA 230
             .:.|..||.|.    |..:.|. .|..|.|....|          |.:||..:.:|.:.|::|.
  Fly   318 -IELFNLIDQNAVGCWHSSMPYS-PQFHGIVDRDDV----------GLVFPADVKIDENKNVWVL 370

  Fly   231 TFN-----------GGTVFKVNPSTGKILLEIKIPTTQITSVAFGGPN 267
            :..           ..|.|::..:....|:|..:  ..:.:.|:|.||
  Fly   371 SDRMPVFLLSDLDYSDTNFRIYTAPLATLIENTV--CDLRNNAYGPPN 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smp-30NP_001262580.1 SGL 18..277 CDD:285626 52/293 (18%)
NHL 168..>248 CDD:302697 18/94 (19%)
NHL repeat 168..208 CDD:271320 10/43 (23%)
yNP_476792.1 MRJP 119..405 CDD:308585 51/295 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.