DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and UBC4

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_009638.1 Gene:UBC4 / 852376 SGDID:S000000286 Length:148 Species:Saccharomyces cerevisiae


Alignment Length:144 Identity:117/144 - (81%)
Similarity:129/144 - (89%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVA 68
            |||.|||.||.||||..||||||||||:||||:||||.||||.||||||:|||||||||||||::
Yeast     5 KRIAKELSDLERDPPTSCSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKIS 69

  Fly    69 FTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREK 133
            |||:|||||||:||:||||||:.|||||||:|||||||||||.|.|||||||||||.||||||.|
Yeast    70 FTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPK 134

  Fly   134 YNELAREWTRKYAM 147
            |...|||||:|||:
Yeast   135 YEATAREWTKKYAV 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 115/141 (82%)
UBC4NP_009638.1 UBCc 3..147 CDD:412187 115/141 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 249 1.000 Domainoid score I346
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2506
Inparanoid 1 1.050 260 1.000 Inparanoid score I627
Isobase 1 0.950 - 0 Normalized mean entropy S23
OMA 1 1.010 - - QHG53976
OrthoFinder 1 1.000 - - FOG0000418
OrthoInspector 1 1.000 - - otm46837
orthoMCL 1 0.900 - - OOG6_100671
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2321
SonicParanoid 1 1.000 - - X311
TreeFam 00.000 Not matched by this tool.
1413.850

Return to query results.
Submit another query.