DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and UBC1

DIOPT Version :10

Sequence 1:NP_731941.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_010462.3 Gene:UBC1 / 851757 SGDID:S000002584 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:145 Identity:70/145 - (48%)
Similarity:98/145 - (67%) Gaps:2/145 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KRINKELQDLGRDPPAQCSAGPVGD-DLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKV 67
            |||.||:|.:..||.|..:...|.: |:.|.:.|.:|||.:||:||.|.:.|..|.:|||||||:
Yeast     5 KRIMKEIQAVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPFKPPKM 69

  Fly    68 AFTTRIYHPNINS-NGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDR 131
            .|.|::|||||:| .|:||||||::.|||.:|:...|:|:.:||..|.|:||...|:|:.|..||
Yeast    70 QFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLRDR 134

  Fly   132 EKYNELAREWTRKYA 146
            |.:|:.|..|||.||
Yeast   135 ESFNKTAALWTRLYA 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_731941.1 UBCc_UBE2D 3..145 CDD:467412 68/142 (48%)
UBC1NP_010462.3 UBCc_UBE2K 4..147 CDD:467420 67/141 (48%)
UBA_3 161..215 CDD:117832
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.