DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and CDC34

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_010339.1 Gene:CDC34 / 851624 SGDID:S000002461 Length:295 Species:Saccharomyces cerevisiae


Alignment Length:148 Identity:50/148 - (33%)
Similarity:71/148 - (47%) Gaps:27/148 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ALKRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMG-PPDSPYQGGVFFLTIHFPTDYPFKPP 65
            |:...:.||:|              ..::|.|...:|. ..||.|.||.|...:.||.|:||.||
Yeast    25 AIPSFHIELED--------------DSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFPEDFPFSPP 75

  Fly    66 KVAFTTRIYHPNINSNGSICLDILRSQ------------WSPALTISKVLLSICSLLCDPNPDDP 118
            :..||..|||||:..:|.:|:.||...            |||..|:..||:||.|||.|||.:.|
Yeast    76 QFRFTPAIYHPNVYRDGRLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNINSP 140

  Fly   119 LVPEIARIYKTDREKYNE 136
            ...:.|..|:.:.|:|.:
Yeast   141 ANVDAAVDYRKNPEQYKQ 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 50/148 (34%)
CDC34NP_010339.1 COG5078 3..170 CDD:227410 50/148 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.