DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and UBC36

DIOPT Version :10

Sequence 1:NP_731941.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001185017.1 Gene:UBC36 / 838260 AraportID:AT1G16890 Length:162 Species:Arabidopsis thaliana


Alignment Length:152 Identity:74/152 - (48%)
Similarity:95/152 - (62%) Gaps:9/152 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KRINKELQDL---------GRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTD 59
            :||.||.|.|         ..||....||.|..:::.::...|:||..|||:||||.|.:..|.:
plant     8 RRIIKETQRLLSEPGNFITSFDPSPGISASPSEENMRYFNVMILGPTQSPYEGGVFKLELFLPEE 72

  Fly    60 YPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIA 124
            ||...|||.|.|:||||||:..|.||||||:.:|||||.|..|||||.:||..|||||||...||
plant    73 YPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIA 137

  Fly   125 RIYKTDREKYNELAREWTRKYA 146
            :.:|::..:..|.|:||||.||
plant   138 KHWKSNEAEAVETAKEWTRLYA 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_731941.1 UBCc_UBE2D 3..145 CDD:467412 72/149 (48%)
UBC36NP_001185017.1 UBCc_UBE2N 6..158 CDD:467433 72/149 (48%)

Return to query results.
Submit another query.