DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and UBC27

DIOPT Version :10

Sequence 1:NP_731941.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001190508.1 Gene:UBC27 / 835159 AraportID:AT5G50870 Length:203 Species:Arabidopsis thaliana


Alignment Length:158 Identity:69/158 - (43%)
Similarity:94/158 - (59%) Gaps:19/158 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RINKELQDLGRDPPAQCSAG----PVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPP 65
            ||.|||||..|:   |.|:|    |..|:|.....||.||..:||:||.|.:.|..|..|||:||
plant     6 RIQKELQDCERN---QDSSGIRVCPKSDNLTRLTGTIPGPIGTPYEGGTFQIDITMPDGYPFEPP 67

  Fly    66 KVAFTTRIYHPNINS-NGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDP---LVPEIARI 126
            |:.|:|:::||||:| :|:||||||:.|||||||:...|:||.:||..|.|.||   :|.|...:
plant    68 KMQFSTKVWHPNISSQSGAICLDILKDQWSPALTLKTALVSIQALLSAPEPKDPQDAVVAEQVLL 132

  Fly   127 --------YKTDREKYNELAREWTRKYA 146
                    |..:.:.:...||.||..:|
plant   133 LHHLNHLRYMKNYQVFVSTARYWTETFA 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_731941.1 UBCc_UBE2D 3..145 CDD:467412 68/155 (44%)
UBC27NP_001190508.1 UBCc_UBE2K 4..158 CDD:467420 68/154 (44%)
UBA_II_E2_UBC27_like 166..201 CDD:270497
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.