DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and UBC8

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_568595.2 Gene:UBC8 / 834173 AraportID:AT5G41700 Length:149 Species:Arabidopsis thaliana


Alignment Length:148 Identity:115/148 - (77%)
Similarity:127/148 - (85%) Gaps:1/148 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALKRINKELQDLGRDPPAQC-SAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKP 64
            ||.|||.|||:||.:|||..| .||||.:|:||||||||||.:|||.||||.:|||||.||||||
plant     1 MASKRILKELKDLQKDPPTSCIFAGPVAEDMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKP 65

  Fly    65 PKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKT 129
            |||||.|:::|||||||||||||||:.|||||||||||||||||||.|||||||||||||.:|||
plant    66 PKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKT 130

  Fly   130 DREKYNELAREWTRKYAM 147
            ||.||...||.||:||||
plant   131 DRAKYEATARNWTQKYAM 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 112/145 (77%)
UBC8NP_568595.2 COG5078 1..148 CDD:227410 113/146 (77%)
UBCc 1..147 CDD:294101 112/145 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 244 1.000 Domainoid score I558
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 259 1.000 Inparanoid score I978
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 1 1.000 - - FOG0000418
OrthoInspector 1 1.000 - - otm2468
orthoMCL 1 0.900 - - OOG6_100671
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X311
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.