DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and UBC12

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001319500.1 Gene:UBC12 / 820017 AraportID:AT3G08700 Length:149 Species:Arabidopsis thaliana


Alignment Length:148 Identity:105/148 - (70%)
Similarity:124/148 - (83%) Gaps:1/148 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALKRINKELQDLGRDPPAQCSAGPVG-DDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKP 64
            ||.|||::||:|:.|.|||.||||||. :|:||||||||||.||||.||||.::|.|.:||||||
plant     1 MASKRISRELRDMQRHPPANCSAGPVAEEDIFHWQATIMGPHDSPYSGGVFTVSIDFSSDYPFKP 65

  Fly    65 PKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKT 129
            |||.|.|::|||||:|.||||||||:.|||||.|.|||||||||||.||||:||||||||.:||.
plant    66 PKVNFKTKVYHPNIDSKGSICLDILKEQWSPAPTTSKVLLSICSLLTDPNPNDPLVPEIAHLYKV 130

  Fly   130 DREKYNELAREWTRKYAM 147
            |:.||...|::||:||||
plant   131 DKSKYESTAQKWTQKYAM 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 102/145 (70%)
UBC12NP_001319500.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.