DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and UBC29

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_565391.1 Gene:UBC29 / 816175 AraportID:AT2G16740 Length:148 Species:Arabidopsis thaliana


Alignment Length:147 Identity:111/147 - (75%)
Similarity:127/147 - (86%) Gaps:0/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALKRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPP 65
            ||.:||.|||::|.||||..|||||.|:|:||||||||||.:|||.||||.:.||||.|||||||
plant     1 MATRRILKELKELQRDPPVSCSAGPTGEDMFHWQATIMGPNESPYSGGVFLVNIHFPPDYPFKPP 65

  Fly    66 KVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTD 130
            ||.|.|:::||||||||:||||||:.|||||||||||||||||||.|||||||||||||.|||||
plant    66 KVVFRTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHIYKTD 130

  Fly   131 REKYNELAREWTRKYAM 147
            :.||..:||.||:|||:
plant   131 KTKYEAMARSWTQKYAL 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 109/144 (76%)
UBC29NP_565391.1 UBCc 1..146 CDD:381827 109/144 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 244 1.000 Domainoid score I558
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 259 1.000 Inparanoid score I978
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 1 1.000 - - FOG0000418
OrthoInspector 1 1.000 - - otm2468
orthoMCL 1 0.900 - - OOG6_100671
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X311
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.780

Return to query results.
Submit another query.