DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and birc6

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:XP_021328806.1 Gene:birc6 / 796547 ZFINID:ZDB-GENE-091202-7 Length:4929 Species:Danio rerio


Alignment Length:135 Identity:42/135 - (31%)
Similarity:66/135 - (48%) Gaps:31/135 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTR-----IYHPNINSNGSICLDILRS----- 91
            |.||.|:||..|.|...::||.|||..||.|...|.     .::||:.::|.:||.||.:     
Zfish  4685 ITGPADTPYANGCFEFDVYFPQDYPNSPPLVNLETTGGHSVRFNPNLYNDGKVCLSILNTWHGRP 4749

  Fly    92 --QWSP-ALTISKVLLSICSLL--CDPNPDDPLVPEIARIYKTDR---------EKYNELAREWT 142
              :|:| ..:..:||:||.||:  .:|..::|       .|:..|         .:|:...|:.|
Zfish  4750 EEKWNPQTSSFLQVLVSIQSLILVAEPYFNEP-------GYERSRGTPSGTQSSREYDGNIRQAT 4807

  Fly   143 RKYAM 147
            .|:||
Zfish  4808 VKWAM 4812

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 40/132 (30%)
birc6XP_021328806.1 BIR 246..319 CDD:237989
BIRC6 3501..3664 CDD:315107
UBCc 4669..4807 CDD:238117 38/128 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.