DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and UBE2D2

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:XP_016865309.1 Gene:UBE2D2 / 7322 HGNCID:12475 Length:173 Species:Homo sapiens


Alignment Length:139 Identity:132/139 - (94%)
Similarity:135/139 - (97%) Gaps:0/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRI 73
            ||.||.|||||||||||||||:||||||||||.||||||||||||||||||||||||||||||||
Human    35 ELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRI 99

  Fly    74 YHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELA 138
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||.:|
Human   100 YHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIA 164

  Fly   139 REWTRKYAM 147
            ||||:||||
Human   165 REWTQKYAM 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 129/136 (95%)
UBE2D2XP_016865309.1 COG5078 35..173 CDD:227410 130/137 (95%)
UBCc 35..172 CDD:294101 129/136 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 282 1.000 Domainoid score I1664
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2506
Inparanoid 1 1.050 300 1.000 Inparanoid score I2702
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 1 1.000 - - FOG0000418
OrthoInspector 1 1.000 - - otm41531
orthoMCL 1 0.900 - - OOG6_100671
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2321
SonicParanoid 1 1.000 - - X311
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.