DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and UBE2D1

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_003329.1 Gene:UBE2D1 / 7321 HGNCID:12474 Length:147 Species:Homo sapiens


Alignment Length:147 Identity:131/147 - (89%)
Similarity:140/147 - (95%) Gaps:0/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALKRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPP 65
            ||||||.|||.||.|||||.|||||||||||||||||||||||.|||||||||:|||||||||||
Human     1 MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPP 65

  Fly    66 KVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTD 130
            |:||||:||||||||||||||||||||||||||:||||||||||||||||||||||:||:|||:|
Human    66 KIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSD 130

  Fly   131 REKYNELAREWTRKYAM 147
            :||||..|||||:||||
Human   131 KEKYNRHAREWTQKYAM 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 128/144 (89%)
UBE2D1NP_003329.1 UBCc 1..146 CDD:412187 128/144 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147873
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 1 1.000 - - FOG0000418
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100671
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2321
SonicParanoid 1 1.000 - - X311
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.750

Return to query results.
Submit another query.