DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and UBE2W

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001001481.3 Gene:UBE2W / 55284 HGNCID:25616 Length:162 Species:Homo sapiens


Alignment Length:134 Identity:49/134 - (36%)
Similarity:64/134 - (47%) Gaps:22/134 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KRINKELQDLGRDPPAQCSAG--PVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPK 66
            ||:.|||..|..|||...:..  .|.:.:..|...:.|.|.:.|:|..|.|...|.:.|||..|:
Human    17 KRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQ 81

  Fly    67 VAFTTR--IYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLL------------------C 111
            |.||..  ..||::.|||.|||.||...|||||::..|.|||.|:|                  |
Human    82 VMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTC 146

  Fly   112 DPNP 115
            :.||
Human   147 NKNP 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 49/134 (37%)
UBE2WNP_001001481.3 UQ_con 18..159 CDD:395127 48/133 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.