DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and ube2s

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001016438.1 Gene:ube2s / 549192 XenbaseID:XB-GENE-1008017 Length:211 Species:Xenopus tropicalis


Alignment Length:144 Identity:54/144 - (37%)
Similarity:81/144 - (56%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LKRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKV 67
            ::::.||:..|..|||......|..:|:...|..|.||..:||.||:|.:.:....|:|..|||.
 Frog    13 IRQVYKEVSTLTSDPPEGIKIIPNEEDITDVQVNIEGPEGTPYAGGIFRMKLILGKDFPAAPPKG 77

  Fly    68 AFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRE 132
            .|.|:|:|||:::||.||:::|:..|...|.|..|||:|..||..|||:..|..|..|:...:.|
 Frog    78 YFLTKIFHPNVSTNGEICVNVLKKDWKAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYE 142

  Fly   133 KYNELAREWTRKYA 146
            :|...||..|..:|
 Frog   143 EYASRARLMTEIHA 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 53/142 (37%)
ube2sNP_001016438.1 UQ_con 16..150 CDD:365926 51/133 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..211 54/144 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.