DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and ube2l3

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:XP_031755551.1 Gene:ube2l3 / 548817 XenbaseID:XB-GENE-970758 Length:160 Species:Xenopus tropicalis


Alignment Length:118 Identity:51/118 - (43%)
Similarity:78/118 - (66%) Gaps:2/118 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQ- 92
            :|..||..|: |.:.||..|.|.:.|:||.:|||||||:.|.|:||||||:..|.:||.::.:: 
 Frog    37 NLLTWQGLIV-PDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAEN 100

  Fly    93 WSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKY 145
            |.||....:|:.|:.:|:.||.|:.||..::|..|..||:|:.:.|.|:|:||
 Frog   101 WKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKY 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 51/118 (43%)
ube2l3XP_031755551.1 UBCc 16..155 CDD:214562 51/118 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.