DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and Ube2u

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:XP_006238505.1 Gene:Ube2u / 500511 RGDID:1565480 Length:337 Species:Rattus norvegicus


Alignment Length:142 Identity:49/142 - (34%)
Similarity:66/142 - (46%) Gaps:3/142 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ALKRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPK 66
            |...:.:|.::|........:|.||..||..|:|.|.|...|..:|.||.|||.|..||...||.
  Rat    15 AYSLLEREFKELQNSRSKGINAYPVSSDLMSWKAEIEGLKYSVCEGLVFHLTIDFSQDYNLVPPV 79

  Fly    67 VAFTTRIYHPNINS-NGSICLDIL--RSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYK 128
            |.|.|..:|||::. .|...|.||  ...|..:.||.::|..:..||..|...:||..|.|.:..
  Rat    80 VKFVTIPFHPNVHPYTGQPSLGILDKPDMWDTSYTILRILFDLQMLLSYPMVKNPLNLEAAELLV 144

  Fly   129 TDREKYNELARE 140
            .|...|..:.||
  Rat   145 KDESLYRTVIRE 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 49/142 (35%)
Ube2uXP_006238505.1 COG5078 13..156 CDD:227410 47/140 (34%)
UBCc 16..156 CDD:238117 46/139 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.