DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and ube2j1

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:XP_012818393.1 Gene:ube2j1 / 496585 XenbaseID:XB-GENE-958459 Length:327 Species:Xenopus tropicalis


Alignment Length:180 Identity:54/180 - (30%)
Similarity:73/180 - (40%) Gaps:51/180 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ALKRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPK 66
            |:||:.||..:| |||.....|.|:.|:||.|..|:.|||||.:.|||:...|..|.:||.|||.
 Frog    33 AVKRLMKEAAEL-RDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPMKPPS 96

  Fly    67 VAFTTRIYHPNINSNG------SICLDIL---RSQWSPALTISKVLLSICSLL------------ 110
            :...|        :||      .|||.|.   ...|.|:.:|...||:|...:            
 Frog    97 IILLT--------ANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFMPTKGEGAIGSLD 153

  Fly   111 --------------------CDPNPDDPLVPEIARIYKTDREKYNELARE 140
                                |..|....|:|..:...:.|.|. .||||:
 Frog   154 YTPEERKALAKRSQDYFCEVCGVNMKCTLLPLSSSSSQADVEA-RELARQ 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 54/180 (30%)
ube2j1XP_012818393.1 UBCc 34..>141 CDD:238117 43/115 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.