DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and ube2r2

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001002600.1 Gene:ube2r2 / 436873 ZFINID:ZDB-GENE-040718-344 Length:250 Species:Danio rerio


Alignment Length:157 Identity:51/157 - (32%)
Similarity:82/157 - (52%) Gaps:20/157 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KRINKELQDLGRDPPAQCSAGPVGD-DLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKV 67
            |.:..||:.|..:|........|.: ||::|:..|.|||::.|:||.|...|.||.|||:.||..
Zfish    11 KALMLELKSLQEEPVEGFRITLVEESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTF 75

  Fly    68 AFTTRIYHPNINSNGSICLDILR-------------SQWSPALTISKVLLSICSLLCDPNPDDPL 119
            .|.|:::||||..||.:|:.||.             .:|:|...:..:|||:.|||.:||...|.
Zfish    76 RFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPA 140

  Fly   120 VPEIARIYKTDRE------KYNELARE 140
            ..:.:.:::..|:      :|.|:.|:
Zfish   141 NVDASVMFRKWRDSKGKDKEYAEIIRK 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 51/157 (32%)
ube2r2NP_001002600.1 COG5078 7..169 CDD:227410 51/157 (32%)
UBCc 11..169 CDD:238117 51/157 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.