DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and ube2z

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001002330.2 Gene:ube2z / 436602 ZFINID:ZDB-GENE-040718-15 Length:380 Species:Danio rerio


Alignment Length:153 Identity:53/153 - (34%)
Similarity:78/153 - (50%) Gaps:12/153 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAF 69
            ||.:::..:.::||......|...|:....|.|.||.|:||:||.|......|.|||..||:|..
Zfish   127 RIKRDIMSIYKEPPPGMFVVPDPHDMTKIHALITGPFDTPYEGGFFLFLFRCPPDYPIHPPRVKL 191

  Fly    70 TTR-----IYHPNINSNGSICLDILRS----QWSPALTISKVLLSICSLLCD-PNPDDPLVPEIA 124
            .|.     .::||...||.:||.||.:    .||||.:||.||:||.||:.: |..::|...:  
Zfish   192 ITTGHNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQ-- 254

  Fly   125 RIYKTDREKYNELAREWTRKYAM 147
            ..:..|.:.|||..|..|.:.|:
Zfish   255 ERHPGDSKNYNECIRHETMRVAV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 52/150 (35%)
ube2zNP_001002330.2 UBCc 127..245 CDD:238117 44/117 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.