DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and Ubc84D

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster


Alignment Length:147 Identity:49/147 - (33%)
Similarity:83/147 - (56%) Gaps:3/147 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ALKRINKELQDLGRDPPAQCSAGPVGDD-LFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPP 65
            |.:|:.:||.||.....:........|: |..|...:: |..:||..|.|.:.|:||..|||.||
  Fly     3 ATRRLTRELSDLVEAKMSTLRNIESSDESLLMWTGLLV-PEKAPYNKGAFRIEINFPPQYPFMPP 66

  Fly    66 KVAFTTRIYHPNINSNGSICLDILRS-QWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKT 129
            |:.|.|:|||||::..|.:||.|:.: .|.|.....:||.::.:::.:|.|:.||..::|..:..
  Fly    67 KILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLRSDLAEEFVR 131

  Fly   130 DREKYNELAREWTRKYA 146
            :.:|:.:.|.|:|:|.|
  Fly   132 EHKKFMKTAEEFTKKNA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 48/145 (33%)
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 49/147 (33%)
UBCc 6..149 CDD:214562 48/144 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442206
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.