DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eff and ube2na

DIOPT Version :9

Sequence 1:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_998651.1 Gene:ube2na / 406807 ZFINID:ZDB-GENE-040426-2873 Length:154 Species:Danio rerio


Alignment Length:143 Identity:70/143 - (48%)
Similarity:90/143 - (62%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVA 68
            :||.||.|.|..:|.....|.|...:..::...|.||.|||::||.|.|.:..|.:||...|||.
Zfish     6 RRIIKETQRLLAEPVPGIKAEPDEGNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVR 70

  Fly    69 FTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREK 133
            |.|:|||||::..|.||||||:.:|||||.|..|||||.:||..|||||||..::|..:||:..:
Zfish    71 FMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQ 135

  Fly   134 YNELAREWTRKYA 146
            ..|.||.|||.||
Zfish   136 AIETARTWTRLYA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
effNP_001262578.1 UBCc 1..146 CDD:412187 68/141 (48%)
ube2naNP_998651.1 UBCc 4..151 CDD:412187 70/143 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.